Rabbit NECAB2 Polyclonal Antibody | anti-NECAB2 antibody

NECAB2 antibody - C-terminal region

Cat. Num. AAA3215747

• Gene Names: NECAB2; EFCBP2; stip-2
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: NECAB2; Polyclonal Antibody; NECAB2 antibody - C-terminal region; anti-NECAB2 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: DAKEEGLEAQISRLAELIGRLESKALWFDLQQRLSDEDGTNMHLQLVRQE
• Sequence Length: 386

• Applicable Applications for anti-NECAB2 antibody: Western Blot (WB)
• Homology: Cow: 86%; Dog: 86%; Guinea Pig: 87%; Horse: 93%; Human: 100%; Mouse: 93%; Rat: 86%
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NECAB2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Related Product Information for anti-NECAB2 antibody

This is a rabbit polyclonal antibody against NECAB2. It was validated on Western Blot

Target Description: The function of this protein remains unknown.

Product Categories/Family for anti-NECAB2 antibody

Polyclonal; Various

NCBI and Uniprot Product Information

• NCBI GI #: 32129214
• NCBI GeneID: 54550
• NCBI Accession #: NP_061938
• NCBI GenBank Nucleotide #: NM_019065
• UniProt Accession #: Q7Z6G3
• Molecular Weight: 42kDa
• NCBI Official Full Name: N-terminal EF-hand calcium-binding protein 2 isoform 1
• NCBI Official Synonym Full Names: N-terminal EF-hand calcium binding protein 2
• NCBI Official Symbol: NECAB2
• NCBI Official Synonym Symbols: EFCBP2; stip-2
• NCBI Protein Information: N-terminal EF-hand calcium-binding protein 2
• UniProt Protein Name: N-terminal EF-hand calcium-binding protein 2
• Protein Family: N-terminal EF-hand calcium-binding protein
• UniProt Gene Name: NECAB2
• UniProt Synonym Gene Names: EFCBP2; EF-hand calcium-binding protein 2; Stip-2
• UniProt Entry Name: NECA2_HUMAN

NCBI Description

The protein encoded by this gene is a neuronal calcium-binding protein that binds to and modulates the function of at least two receptors, adenosine A(2A) receptor and metabotropic glutamate receptor type 5. [provided by RefSeq, Jul 2016]