Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (2'-PDE antibody (MBS5300370) used at 1 ug/ml to detect target protein.)

Rabbit anti-Human, Mouse 2'-PDE Polyclonal Antibody | anti-2'-PDE antibody

2'-PDE antibody

Gene Names
PDE12; 2'-PDE
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
2'-PDE; Polyclonal Antibody; 2'-PDE antibody; Polyclonal 2'-PDE; Anti-2'-PDE; Phosphodiesterase; anti-2'-PDE antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Specificity
2'-PDE antibody was raised against the middle region of 2'-Pde
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of 2'-PDE antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
609
Applicable Applications for anti-2'-PDE antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
2'-PDE is an enzyme that cleaves 2',5'-phosphodiester bond linking adenosines of the 5'-triphosphorylated oligoadenylates, triphosphorylated oligoadenylates referred as 2-5A modulates the 2-5A system. This enzyme degraded triphosphorylated 2-5A to produce AMP and ATP. 2'-PDE also cleaves 3',5'-phosphodiester bond of oligoadenylates. 2'-PDE play a role as a negative regulator of the 2-5A system that is one of the major pathways for antiviral and antitumor functions induced by interferons (IFNs). Suppression of this enzyme induces reduction of viral replication in Hela cells, thus counteracting the antiviral pathway probably by inhibiting the 2-5A system.
Cross-Reactivity
Human,Mouse
Immunogen
2'-PDE antibody was raised using the middle region of 2'-Pde corresponding to a region with amino acids CLDYIFIDLNALEVEQVIPLPSHEEVTTHQALPSVSHPSDHIALVCDLKW
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(2'-PDE antibody (MBS5300370) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (2'-PDE antibody (MBS5300370) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-2'-PDE antibody
Rabbit polyclonal 2'-PDE antibody raised against the middle region of 2'-Pde
Product Categories/Family for anti-2'-PDE antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
67 kDa (MW of target protein)
NCBI Official Full Name
2',5'-phosphodiesterase 12
NCBI Official Synonym Full Names
phosphodiesterase 12
NCBI Official Symbol
PDE12
NCBI Official Synonym Symbols
2'-PDE
NCBI Protein Information
2',5'-phosphodiesterase 12
UniProt Protein Name
2',5'-phosphodiesterase 12
UniProt Gene Name
PDE12
UniProt Synonym Gene Names
2'-PDE; 2-PDE
UniProt Entry Name
PDE12_HUMAN

Uniprot Description

PDE12: Enzyme that cleaves 2',5'-phosphodiester bond linking adenosines of the 5'-triphosphorylated oligoadenylates, triphosphorylated oligoadenylates referred as 2-5A modulates the 2-5A system. This enzyme degraded triphosphorylated 2-5A to produce AMP and ATP. Also cleaves 3',5'-phosphodiester bond of oligoadenylates. Plays a role as a negative regulator of the The 2-5A system that is one of the major pathways for antiviral and antitumor functions induced by interferons (IFNs). Suppression of this enzyme induces reduction of viral replication in Hela cells, thus counteracting the antiviral pathway probably by inhibiting the 2-5A system. Belongs to the CCR4/nocturin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Phosphodiesterase; EC 3.1.13.4

Chromosomal Location of Human Ortholog: 3p14.3

Cellular Component: mitochondrial matrix

Molecular Function: poly(A)-specific ribonuclease activity; metal ion binding

Biological Process: mRNA processing

Research Articles on 2'-PDE

Similar Products

Product Notes

The 2'-PDE pde12 (Catalog #AAA5300370) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The 2'-PDE antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's 2'-PDE can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the 2'-PDE pde12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "2'-PDE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.