Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CARM1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CARM1 Polyclonal Antibody | anti-CARM1 antibody

CARM1 Antibody - C-terminal region

Gene Names
CARM1; PRMT4
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CARM1; Polyclonal Antibody; CARM1 Antibody - C-terminal region; anti-CARM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SIVAQVDQTGSKSSNLLDLKNPFFRYTGTTPSPPPGSHYTSPSENMWNTG
Sequence Length
585
Applicable Applications for anti-CARM1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CARM1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CARM1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CARM1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CARM1 antibody
This is a rabbit polyclonal antibody against CARM1. It was validated on Western Blot

Target Description: This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts specifically on histones and other chromatin-associated proteins and is involved in regulation of gene expression. The enzyme may act in association with other proteins or within multi-protein complexes and may play a role in cell type-specific functions and cell lineage specification. A related pseudogene is located on chromosome 9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
histone-arginine methyltransferase CARM1 isoform X1
NCBI Official Synonym Full Names
coactivator associated arginine methyltransferase 1
NCBI Official Symbol
CARM1
NCBI Official Synonym Symbols
PRMT4
NCBI Protein Information
histone-arginine methyltransferase CARM1
UniProt Protein Name
Histone-arginine methyltransferase CARM1
UniProt Gene Name
CARM1
UniProt Synonym Gene Names
PRMT4
UniProt Entry Name
CARM1_HUMAN

NCBI Description

This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts specifically on histones and other chromatin-associated proteins and is involved in regulation of gene expression. The enzyme may act in association with other proteins or within multi-protein complexes and may play a role in cell type-specific functions and cell lineage specification. A related pseudogene is located on chromosome 9. [provided by RefSeq, Aug 2013]

Uniprot Description

CARM1: a protein arginine methyltransferase that methylates histones and other proteins involved in DNA packaging, transcription regulation, pre-mRNA splicing, and mRNA stability. Methylates (mono- and asymmetric dimethylation) the guanidino nitrogens of arginine residues. A key epigenetic regulator of hematopoiesis affecting multiple lineages. Recruited to promoters upon gene activation together with histone acetyltransferases from P300 and p160 families, methylates histone H3 at R17 (H3R17me), forming mainly asymmetric dimethylarginine (H3R17me2a), leading to activate transcription via chromatin remodeling. During nuclear hormone receptor activation and TCF7L2 activation, acts synergically with P300 and either one of the p160 histone acetyltransferases SRC1, NCoA2 and SRC-3 or CTNNB1 to activate transcription. During myogenic transcriptional activation, acts together with SRC-3 as a coactivator for MEF2C. During monocyte inflammatory stimulation, acts together with P300 as a coactivator for NF-kappa-B. Acts as coactivator for PPARG, promotes adipocyte differentiation and the accumulation of brown fat tissue. Plays a role in the regulation of pre-mRNA alternative splicing by methylation of splicing factors. Also seems to be involved in p53 transcriptional activation. Methylates P300, both at R 2142, which may loosen its interaction with NCoA2, and at R580 and R604 in the KIX domain, which impairs its interaction with CREB and inhibits CREB-dependent transcriptional activation. Methylates RNA-binding proteins PABPC1, ELAVL1 and ELAV4, which may affect their mRNA- stabilizing properties and the half-life of their target mRNAs. Interacts with the C-terminus of NCoA2, SRC-3 and SRC1. Part of a complex consisting of CARM1, P300 and NCoA2. Interacts with FLII, TP53, myogenic factor MEF2, P300, TRIM24, CREBBP and CTNNB1. Identified in a complex containing CARM1, TRIM24 and NCoA2. Interacts with SRC3. Interacts with SNRPC. Interacts with NR1H4. Interacts with RELA. Interacts with HTLV-1 Tax-1. Overexpressed in prostate adenocarcinomas and high-grade prostatic intraepithelial neoplasia. Methylation of H3R17 (H3R17me) by CARM1 is stimulated by preacetylation of H3 K18 (H3K18ac) H3 K23 (H3K23ac) by EP300 and blocked by citrullination of H3 R17 (H3R17ci) by PADI4. Belongs to the protein arginine N-methyltransferase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.1.1.125; Methyltransferase, protein arginine; Methyltransferase; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: nucleoplasm; cytoplasm; nucleus; cytosol

Molecular Function: histone methyltransferase activity; protein-arginine omega-N asymmetric methyltransferase activity; protein binding; protein-arginine N-methyltransferase activity; protein homodimerization activity; ligand-dependent nuclear receptor transcription coactivator activity; transcription coactivator activity; histone-arginine N-methyltransferase activity; beta-catenin binding; protein methyltransferase activity

Biological Process: regulation of estrogen receptor signaling pathway; establishment and/or maintenance of chromatin architecture; response to cAMP; estrogen receptor signaling pathway; transcription, DNA-dependent; viral reproduction; pathogenesis; peptidyl-arginine methylation, to asymmetrical-dimethyl arginine; cellular lipid metabolic process; histone methylation; regulation of transcription, DNA-dependent; positive regulation of cell proliferation; positive regulation of fat cell differentiation; negative regulation of protein binding

Research Articles on CARM1

Similar Products

Product Notes

The CARM1 carm1 (Catalog #AAA3219188) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CARM1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CARM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CARM1 carm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SIVAQVDQTG SKSSNLLDLK NPFFRYTGTT PSPPPGSHYT SPSENMWNTG. It is sometimes possible for the material contained within the vial of "CARM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.