Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Figure 1. Western blot analysis of 12 Lipoxygenase using anti-12 Lipoxygenase antibody (MBS178664).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.lane 1: rat spleen tissue lysates,lane 2: mouse spleen tissue lysates,lane 3: COLO320 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-12 Lipoxygenase antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for 12 Lipoxygenase at approximately 80KD. The expected band size for 12 Lipoxygenase is at 75KD. )

Rabbit 12 Lipoxygenase Polyclonal Antibody | anti-ALOX12 antibody

Anti-12 Lipoxygenase Antibody

Gene Names
ALOX12; LOG12; 12-LOX; 12S-LOX
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
12 Lipoxygenase; Polyclonal Antibody; Anti-12 Lipoxygenase Antibody; ALOX12; arachidonate 12-lipoxygenase; EC1.13.11.31; Lipoxin synthase 12-LO; LOG12; P18054; Platelet-type lipoxygenase 12; Arachidonate 12-lipoxygenase; 12S-type; anti-ALOX12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Sequence Length
663
Applicable Applications for anti-ALOX12 antibody
Western Blot (WB)
Application Notes
Western Blot
Concentration: 0.1-0.5ug/ml
Tested Species: Hu, Ms, Rat

Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Contents
Each vial contains 4mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human 12 Lipoxygenase (186-231aa ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Figure 1. Western blot analysis of 12 Lipoxygenase using anti-12 Lipoxygenase antibody (MBS178664).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.lane 1: rat spleen tissue lysates,lane 2: mouse spleen tissue lysates,lane 3: COLO320 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-12 Lipoxygenase antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for 12 Lipoxygenase at approximately 80KD. The expected band size for 12 Lipoxygenase is at 75KD. )

Western Blot (WB) (Figure 1. Western blot analysis of 12 Lipoxygenase using anti-12 Lipoxygenase antibody (MBS178664).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.lane 1: rat spleen tissue lysates,lane 2: mouse spleen tissue lysates,lane 3: COLO320 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-12 Lipoxygenase antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for 12 Lipoxygenase at approximately 80KD. The expected band size for 12 Lipoxygenase is at 75KD. )
Related Product Information for anti-ALOX12 antibody
Rabbit IgG polyclonal antibody for Arachidonate 12-lipoxygenase, 12S-type(ALOX12) detection.
Background: ALOX12, Arachidonate 12-lipoxygenase, is an enzyme that in humans is encoded by the ALOX12 gene. By fluorescence in situ hybridization, the ALOX12 gene is located in band 17p13.1. The gene consists of 14 exons with 13 introns and spans approximately 15 kb of DNA Arachidonate 12-lipoxygenase introduces a molecular oxygen into the C-12 position of arachidonic acid to produce 12(S)-hydroperoxy-5, 8, 10, 14-eicosatetraenoic acid. The major pathway of arachidonic acid metabolism in human platelets proceeds via a 12-lipoxygenase enzyme. Expression of the LOG12 gene was detected in human erythroleukemia cells, platelets, and human umbilical vein endothelial cells by reverse transcription-PCR analysis.
References
1. Funk, C. D., Furci, L., FitzGerald, G. A.Molecular cloning, primary structure, and expression of the human platelet/erythroleukemia cell 12-lipoxygenase.Proc. Nat. Acad. Sci. 87: 5638-5642, 1990.
2. Natarajan, R., Esworthy, R., Bai, W., Gu, J.-L., Wilczynski, S., Nadler, J.Increased 12-lipoxygenase expression in breast cancer tissues and cells. Regulation by epidermal growth factor.J. Clin. Endocr. Metab. 82: 1790-1798, 1997.
3. Yoshimoto, T., Arakawa, T., Hada, T., Yamamoto, S., Takahashi, E.Structure and chromosomal localization of human arachidonate 12-lipoxygenase gene.J. Biol. Chem. 267: 24805-24809, 1992.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
239
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75,694 Da
NCBI Official Full Name
arachidonate 12-lipoxygenase, 12S-type
NCBI Official Synonym Full Names
arachidonate 12-lipoxygenase, 12S type
NCBI Official Symbol
ALOX12
NCBI Official Synonym Symbols
LOG12; 12-LOX; 12S-LOX
NCBI Protein Information
arachidonate 12-lipoxygenase, 12S-type
UniProt Protein Name
Arachidonate 12-lipoxygenase, 12S-type
UniProt Gene Name
ALOX12
UniProt Synonym Gene Names
12LO; LOG12; 12S-LOX; 12S-lipoxygenase

Uniprot Description

ALOX12: Oxygenase and 14,15-leukotriene A4 synthase activity. Belongs to the lipoxygenase family.

Protein type: Apoptosis; EC 1.13.11.31; Lipid Metabolism - arachidonic acid; Oxidoreductase

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: cytoplasm; cytosol; membrane; sarcolemma

Molecular Function: arachidonate 12-lipoxygenase activity; hepoxilin A3 synthase activity; hepoxilin-epoxide hydrolase activity; lipoxygenase activity; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen; protein binding

Biological Process: arachidonic acid metabolic process; cell motility; fatty acid oxidation; hepoxilin biosynthetic process; hepoxilin metabolic process; linoleic acid metabolic process; lipoxygenase pathway; negative regulation of apoptosis; positive regulation of angiogenesis; positive regulation of cell adhesion; positive regulation of cell growth; positive regulation of cell migration; positive regulation of cell proliferation

Research Articles on ALOX12

Similar Products

Product Notes

The ALOX12 alox12 (Catalog #AAA178664) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-12 Lipoxygenase Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's 12 Lipoxygenase can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml Tested Species: Hu, Ms, Rat Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Researchers should empirically determine the suitability of the ALOX12 alox12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "12 Lipoxygenase, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.