Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Lipid phosphate phosphohydrolase 3 (PPAP2B) Recombinant Protein | PPAP2B recombinant protein

Recombinant Human Lipid phosphate phosphohydrolase 3 (PPAP2B)

Gene Names
PLPP3; LPP3; VCIP; Dri42; PAP2B; PPAP2B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lipid phosphate phosphohydrolase 3 (PPAP2B); Recombinant Human Lipid phosphate phosphohydrolase 3 (PPAP2B); PPAP2B recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-311aa; Full length protein
Sequence
MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIK PYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQN PYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYR CRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAFY TGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRKEILSPVD IIDRNNHHNMM
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for PPAP2B recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,116 Da
NCBI Official Full Name
phospholipid phosphatase 3
NCBI Official Synonym Full Names
phospholipid phosphatase 3
NCBI Official Symbol
PLPP3
NCBI Official Synonym Symbols
LPP3; VCIP; Dri42; PAP2B; PPAP2B
NCBI Protein Information
phospholipid phosphatase 3
UniProt Protein Name
Phospholipid phosphatase 3
UniProt Gene Name
PLPP3
UniProt Synonym Gene Names
PAP-2b; PAP2b; VCIP
UniProt Entry Name
PLPP3_HUMAN

NCBI Description

The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells. [provided by RefSeq, Mar 2010]

Uniprot Description

PPAP2B: Catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol (DG). In addition it hydrolyzes lysophosphatidic acid (LPA), ceramide-1-phosphate (C-1-P) and sphingosine-1- phosphate (S-1-P). The relative catalytic efficiency is LPA = PA > C-1-P > S-1-P. May be involved in cell adhesion and in cell-cell interactions. Belongs to the PA-phosphatase related phosphoesterase family.

Protein type: Membrane protein, multi-pass; Phosphatase, lipid; Lipid Metabolism - glycerophospholipid; EC 3.1.3.4; Lipid Metabolism - ether lipid; Lipid Metabolism - sphingolipid; Lipid Metabolism - glycerolipid; Membrane protein, integral; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1p32.2

Cellular Component: adherens junction; endoplasmic reticulum membrane; Golgi apparatus; integral to plasma membrane; membrane; plasma membrane

Molecular Function: integrin binding; lipid phosphatase activity; phosphatidate phosphatase activity; phosphoprotein phosphatase activity; protein binding; sphingosine-1-phosphate phosphatase activity

Biological Process: Bergmann glial cell differentiation; blood vessel development; gastrulation with mouth forming second; germ cell migration; homotypic cell-cell adhesion; lipid metabolic process; negative regulation of protein amino acid phosphorylation; phospholipid dephosphorylation; phospholipid metabolic process; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of transcription factor activity; protein amino acid dephosphorylation; protein stabilization; regulation of Wnt receptor signaling pathway; sphingolipid biosynthetic process

Research Articles on PPAP2B

Similar Products

Product Notes

The PPAP2B plpp3 (Catalog #AAA7026875) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-311aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the PPAP2B plpp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQNYKYDKAI VPESKNGGSP ALNNNPRRSG SKRVLLICLD LFCLFMAGLP FLIIETSTIK PYHRGFYCND ESIKYPLKTG ETINDAVLCA VGIVIAILAI ITGEFYRIYY LKKSRSTIQN PYVAALYKQV GCFLFGCAIS QSFTDIAKVS IGRLRPHFLS VCNPDFSQIN CSEGYIQNYR CRGDDSKVQE ARKSFFSGHA SFSMYTMLYL VLYLQARFTW RGARLLRPLL QFTLIMMAFY TGLSRVSDHK HHPSDVLAGF AQGALVACCI VFFVSDLFKT KTTLSLPAPA IRKEILSPVD IIDRNNHHNM M. It is sometimes possible for the material contained within the vial of "Lipid phosphate phosphohydrolase 3 (PPAP2B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.