E3 SUMO-protein ligase PIAS3 (Pias3) Recombinant Protein | Pias3 recombinant protein

Recombinant Mouse E3 SUMO-protein ligase PIAS3 (Pias3)

Cat. Num. AAA1069425

• Gene Names: Pias3; Pias3l
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: E3 SUMO-protein ligase PIAS3 (Pias3); Recombinant Mouse E3 SUMO-protein ligase PIAS3 (Pias3); Pias3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-628, Full length protein
• Sequence: MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKELYRRRFPRKTLGPSDLSLLSLPPGTSPVGSPGPLAPIPPTLLTPGTLLGPKREVDMHPPLPQPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQLQQILTSREVLPGAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSRPINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILNSCSDCDEIQFMEDGSWCPMKPKKEASEVCPPPGYGLDGLQYSAVQEGIQPESKKRVEVIDLTIESSSDEEDLPPTKKHCPVTSAAIPALPGSKGALTSGHQPSSVLRSPAMGTLGSDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQHYGPSVITSLDEQDTLGHFFQYRGTPSHFLGPLAPTLGSSHRSSTPAPPPGRVSSIVAPGSSLREGHGGPLPSGPSLTGCRSDVISLD
• Sequence Length: 628

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Pias3 recombinant protein

This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined.

NCBI and Uniprot Product Information

• NCBI GI #: 260099693
• NCBI GeneID: 229615
• NCBI Accession #: NP_001159421.1
• NCBI GenBank Nucleotide #: NM_001165949.1
• UniProt Accession #: O54714; Q80WF8; Q8R598
• Molecular Weight: 64,741 Da
• NCBI Official Full Name: E3 SUMO-protein ligase PIAS3 isoform 3
• NCBI Official Synonym Full Names: protein inhibitor of activated STAT 3
• NCBI Official Symbol: Pias3
• NCBI Official Synonym Symbols: Pias3l
• NCBI Protein Information: E3 SUMO-protein ligase PIAS3
• UniProt Protein Name: E3 SUMO-protein ligase PIAS3
• Protein Family: E3 SUMO-protein ligase
• UniProt Gene Name: Pias3

Uniprot Description

Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway and the steroid hormone signaling pathway. Repressor of STAT3 signaling via inhibiting STAT3 DNA-binding and suppressing cell growth. Repressor of MITF transcriptional activity. Enhances the sumoylation of MTA1 and may participate in its paralog-selective sumoylation. Sumoylates CCAR2 which promotes its interaction with SIRT1 (). Diminishes the sumoylation of ZFHX3 by preventing the colocalization of ZFHX3 with SUMO1 in the nucleus ().