Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cytochrome b6-f complex iron-sulfur subunit (petC) Recombinant Protein | petC recombinant protein

Recombinant Synechococcus sp. Cytochrome b6-f complex iron-sulfur subunit (petC)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome b6-f complex iron-sulfur subunit (petC); Recombinant Synechococcus sp. Cytochrome b6-f complex iron-sulfur subunit (petC); Recombinant Cytochrome b6-f complex iron-sulfur subunit (petC); Cytochrome b6-f complex iron-sulfur subunit EC= 1.10.9.1; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; ISP; RISP Rieske iron-sulfur protein; petC recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-180
Sequence
MTQLSGSSDVPDLGRRQFLNLLWVGTAAGTALGGLYPVIKYFIPPSSGGAGGGVIAKDALGNDIIVSDYLQTHTAGDRSLAQGLKGDPTYVVVEGDNTISSYGINAICTHLGCVVPWNTAENKFMCPCHGSQYDETGKVVRGPAPLSLALVHAEVTEDDKISFTDWTETDFRTDEAPWWA
Sequence Length
180
Species
Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,178 Da
NCBI Official Full Name
cytochrome b6-f complex iron-sulfur subunit
NCBI Official Symbol
petC
NCBI Protein Information
cytochrome b6-f complex iron-sulfur subunit
UniProt Protein Name
Cytochrome b6-f complex iron-sulfur subunit
Protein Family
UniProt Gene Name
petC
UniProt Synonym Gene Names
ISP; RISP
UniProt Entry Name
UCRI_SYNP2

Uniprot Description

Function: Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions

By similarity. HAMAP-Rule MF_01335

Catalytic activity: Plastoquinol + 2 oxidized plastocyanin + 2 H+(Side 1) = plastoquinone + 2 reduced plastocyanin + 2 H+(Side 2). HAMAP-Rule MF_01335

Cofactor: Binds 1 2Fe-2S cluster per subunit

By similarity. HAMAP-Rule MF_01335

Subunit structure: The 4 large subunits of the cytochrome b6-f complex are cytochrome b6, subunit IV (17 kDa polypeptide, PetD), cytochrome f and the Rieske protein, while the 4 small subunits are PetG, PetL, PetM and PetN. The complex functions as a dimer

By similarity.

Subcellular location: Cellular thylakoid membrane; Single-pass membrane protein

By similarity. Note: The transmembrane helix obliquely spans the membrane in one monomer, and its extrinsic C-terminal domain is part of the other monomer

By similarity. HAMAP-Rule MF_01335

Miscellaneous: The Rieske iron-sulfur protein is a high potential 2Fe-2S protein. HAMAP-Rule MF_01335

Sequence similarities: Contains 1 Rieske domain.

Similar Products

Product Notes

The petC petc (Catalog #AAA1159592) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-180. The amino acid sequence is listed below: MTQLSGSSDV PDLGRRQFLN LLWVGTAAGT ALGGLYPVIK YFIPPSSGGA GGGVIAKDAL GNDIIVSDYL QTHTAGDRSL AQGLKGDPTY VVVEGDNTIS SYGINAICTH LGCVVPWNTA ENKFMCPCHG SQYDETGKVV RGPAPLSLAL VHAEVTEDDK ISFTDWTETD FRTDEAPWWA. It is sometimes possible for the material contained within the vial of "Cytochrome b6-f complex iron-sulfur subunit (petC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.