Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CD93 expression in transfected 293T cell line by CD93 monoclonal antibody (M04), clone 1A4.Lane 1: CD93 transfected lysate (Predicted MW: 71.72 KDa).Lane 2: Non-transfected lysate.)

Mouse CD93 Monoclonal Antibody | anti-CD93 antibody

CD93 (CD93 Molecule, C1QR1, C1qR(P), C1qRP, CDw93, MXRA4, dJ737E23.1) (PE)

Gene Names
CD93; C1QR1; C1qRP; CDw93; ECSM3; MXRA4; C1qR(P); dJ737E23.1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
CD93; Monoclonal Antibody; CD93 (CD93 Molecule; C1QR1; C1qR(P); C1qRP; CDw93; MXRA4; dJ737E23.1) (PE); CD93 Molecule; dJ737E23.1; anti-CD93 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG3, lambda
Clone Number
1A4
Specificity
Recognizes CD93.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CD93 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CD93 (NP_036204, 33aa-140aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKR
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CD93 expression in transfected 293T cell line by CD93 monoclonal antibody (M04), clone 1A4.Lane 1: CD93 transfected lysate (Predicted MW: 71.72 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CD93 expression in transfected 293T cell line by CD93 monoclonal antibody (M04), clone 1A4.Lane 1: CD93 transfected lysate (Predicted MW: 71.72 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-CD93 antibody
The protein encoded by this gene is a cell-surface glycoprotein and type I membrane protein that was originally identified as a myeloid cell-specific marker. The encoded protein was once thought to be a receptor for C1q, but now is thought to instead be involved in intercellular adhesion and in the clearance of apoptotic cells. The intracellular cytoplasmic tail of this protein has been found to interact with moesin, a protein known to play a role in linking transmembrane proteins to the cytoskeleton and in the remodelling of the cytoskeleton. [provided by RefSeq]
Product Categories/Family for anti-CD93 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59.3kDa (567aa) 70-100KDa (SDS-PAGE under reducing conditions.)
NCBI Official Full Name
complement component C1q receptor
NCBI Official Synonym Full Names
CD93 molecule
NCBI Official Symbol
CD93
NCBI Official Synonym Symbols
C1QR1; C1qRP; CDw93; ECSM3; MXRA4; C1qR(P); dJ737E23.1
NCBI Protein Information
complement component C1q receptor
UniProt Protein Name
Complement component C1q receptor
UniProt Gene Name
CD93
UniProt Synonym Gene Names
C1QR1; MXRA4; C1qR; C1qR(p); C1qRp
UniProt Entry Name
C1QR1_HUMAN

NCBI Description

The protein encoded by this gene is a cell-surface glycoprotein and type I membrane protein that was originally identified as a myeloid cell-specific marker. The encoded protein was once thought to be a receptor for C1q, but now is thought to instead be involved in intercellular adhesion and in the clearance of apoptotic cells. The intracellular cytoplasmic tail of this protein has been found to interact with moesin, a protein known to play a role in linking transmembrane proteins to the cytoskeleton and in the remodelling of the cytoskeleton. [provided by RefSeq, Jul 2008]

Research Articles on CD93

Similar Products

Product Notes

The CD93 cd93 (Catalog #AAA6186039) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CD93 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD93 cd93 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD93, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.