Procollagen C-endopeptidase enhancer 1 (Pcolce) Recombinant Protein | Pcolce recombinant protein
Recombinant Rat Procollagen C-endopeptidase enhancer 1 (Pcolce)
Gene Names
Pcolce; PCPE
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Procollagen C-endopeptidase enhancer 1 (Pcolce); Recombinant Rat Procollagen C-endopeptidase enhancer 1 (Pcolce); Pcolce recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-468, Full length protein
Sequence
QTPNYTRPVFLCGGDVTGESGYVASEGFPNLYPPNKKCIWTITVPEGQTVSLSFRVFDMELHPSCRYDALEVFAGSGTSGQRLGRFCGTFRPAPVVAPGNQVTLRMTTDEGTGGRGFLLWYSGRATSGTEHQFCGGRMEKAQGTLTTPNWPESDYPPGISCSWHIIAPSNQVIMLTFGKFDVEPDTYCRYDSVSVFNGAVSDDSKRLGKFCGDKAPSPISSEGNELLVQFVSDLSVTADGFSASYRTLPRDAVEKESAPSPGEDAQHGPQSRSDPKTGTGPKVKPPSKPKVQPVEKPEGSPATQATPVAPDAPSITCPKQYKRSGTLQSNFCSSSLVVTGTVKAMVRGPGEGLTVTVSLLGVYKTGDLDLPSPASGTSLKFYVPCKQMPPMKKGASYLLMGQVEENRGPILPPESFVVLYRPNQDQILSNLSKRKCPSQPRPDA
Sequence Length
444
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Pcolce recombinant protein
Fibrillar collagen types I-III are synthesized as precursor molecules known as procollagens. These precursors contain amino- and carboxyl-terminal peptide extensions known as N- and C-propeptides, respectively, which are cleaved, upon secretion of procollagen from the cell, to yield the mature triple helical, highly structured fibrils. This gene encodes a glycoprotein which binds and drives the enzymatic cleavage of type I procollagen and heightens C-proteinase activity.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,185 Da
NCBI Official Full Name
procollagen C-endopeptidase enhancer 1
NCBI Official Synonym Full Names
procollagen C-endopeptidase enhancer
NCBI Official Symbol
Pcolce
NCBI Official Synonym Symbols
PCPE
NCBI Protein Information
procollagen C-endopeptidase enhancer 1
UniProt Protein Name
Procollagen C-endopeptidase enhancer 1
Protein Family
UniProt Gene Name
Pcolce
UniProt Synonym Gene Names
Pcpe1; PCPE-1; Procollagen C-proteinase enhancer 1
NCBI Description
may play a role in type I collagen processing; may bind and stabilize RNA during protein synthesis [RGD, Feb 2006]
Uniprot Description
Binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.
Research Articles on Pcolce
Similar Products
Product Notes
The Pcolce pcolce (Catalog #AAA1029610) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-468, Full length protein. The amino acid sequence is listed below: QTPNYTRPVF LCGGDVTGES GYVASEGFPN LYPPNKKCIW TITVPEGQTV SLSFRVFDME LHPSCRYDAL EVFAGSGTSG QRLGRFCGTF RPAPVVAPGN QVTLRMTTDE GTGGRGFLLW YSGRATSGTE HQFCGGRMEK AQGTLTTPNW PESDYPPGIS CSWHIIAPSN QVIMLTFGKF DVEPDTYCRY DSVSVFNGAV SDDSKRLGKF CGDKAPSPIS SEGNELLVQF VSDLSVTADG FSASYRTLPR DAVEKESAPS PGEDAQHGPQ SRSDPKTGTG PKVKPPSKPK VQPVEKPEGS PATQATPVAP DAPSITCPKQ YKRSGTLQSN FCSSSLVVTG TVKAMVRGPG EGLTVTVSLL GVYKTGDLDL PSPASGTSLK FYVPCKQMPP MKKGASYLLM GQVEENRGPI LPPESFVVLY RPNQDQILSN LSKRKCPSQP RPDA. It is sometimes possible for the material contained within the vial of "Procollagen C-endopeptidase enhancer 1 (Pcolce), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
