Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PCOC1Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human PCOLCE Polyclonal Antibody | anti-PCOLCE antibody

PCOLCE Antibody - C-terminal region

Gene Names
PCOLCE; PCPE; PCPE1; PCPE-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PCOLCE; Polyclonal Antibody; PCOLCE Antibody - C-terminal region; anti-PCOLCE antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSEGNELLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKV
Sequence Length
449
Applicable Applications for anti-PCOLCE antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PCOC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PCOC1Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PCOC1Sample Type: 786-0 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PCOLCE antibody
This is a rabbit polyclonal antibody against PCOC1. It was validated on Western Blot

Target Description: Fibrillar collagen types I-III are synthesized as precursor molecules known as procollagens. These precursors contain amino- and carboxyl-terminal peptide extensions known as N- and C-propeptides, respectively, which are cleaved, upon secretion of procollagen from the cell, to yield the mature triple helical, highly structured fibrils. This gene encodes a glycoprotein which binds and drives the enzymatic cleavage of type I procollagen and heightens C-proteinase activity.
Product Categories/Family for anti-PCOLCE antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
procollagen C-endopeptidase enhancer 1
NCBI Official Synonym Full Names
procollagen C-endopeptidase enhancer
NCBI Official Symbol
PCOLCE
NCBI Official Synonym Symbols
PCPE; PCPE1; PCPE-1
NCBI Protein Information
procollagen C-endopeptidase enhancer 1
UniProt Protein Name
Procollagen C-endopeptidase enhancer 1
UniProt Gene Name
PCOLCE
UniProt Synonym Gene Names
PCPE1; PCPE-1
UniProt Entry Name
PCOC1_HUMAN

NCBI Description

Fibrillar collagen types I-III are synthesized as precursor molecules known as procollagens. These precursors contain amino- and carboxyl-terminal peptide extensions known as N- and C-propeptides, respectively, which are cleaved, upon secretion of procollagen from the cell, to yield the mature triple helical, highly structured fibrils. This gene encodes a glycoprotein which binds and drives the enzymatic cleavage of type I procollagen and heightens C-proteinase activity. [provided by RefSeq, Jul 2008]

Uniprot Description

PCOLCE: Binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.

Protein type: Extracellular matrix; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 7q22

Cellular Component: extracellular matrix; extracellular space

Molecular Function: heparin binding; collagen binding; protein binding; protease activator activity

Biological Process: multicellular organismal development; proteolysis

Research Articles on PCOLCE

Similar Products

Product Notes

The PCOLCE pcolce (Catalog #AAA3219535) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PCOLCE Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCOLCE can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PCOLCE pcolce for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSEGNELLVQ FVSDLSVTAD GFSASYKTLP RGTAKEGQGP GPKRGTEPKV. It is sometimes possible for the material contained within the vial of "PCOLCE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.