Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of U-251MG cells, using PCOLCE antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)

Rabbit anti-Human PCOLCE Polyclonal Antibody | anti-PCOLCE antibody

PCOLCE Polyclonal Antibody

Gene Names
PCOLCE; PCPE; PCPE1; PCPE-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
PCOLCE; Polyclonal Antibody; PCOLCE Polyclonal Antibody; PCPE; PCPE-1; PCPE1; anti-PCOLCE antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
LTTPNWPESDYPPGISCSWHIIAPPDQVIALTFEKFDLEPDTYCRYDSVSVFNGAVSDDSRRLGKFCGDAVPGSISSEGNELLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKSQPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPSPPTGASLKFYVPCKQCPPMKKGVSYLLMGQVEENRGPVLPPESFVVLHRPN
Sequence Length
449
Applicable Applications for anti-PCOLCE antibody
Western Blot (WB)
Application Notes
WB: 1:200 - 1:2000
Immunogen
Recombinant protein of human PCOLCE
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Secreted
Positive Samples
U-251MG
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of U-251MG cells, using PCOLCE antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of U-251MG cells, using PCOLCE antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
Related Product Information for anti-PCOLCE antibody
Fibrillar collagen types I-III are synthesized as precursor molecules known as procollagens. These precursors contain amino- and carboxyl-terminal peptide extensions known as N- and C-propeptides, respectively, which are cleaved, upon secretion of procollagen from the cell, to yield the mature triple helical, highly structured fibrils. This gene encodes a glycoprotein which binds and drives the enzymatic cleavage of type I procollagen and heightens C-proteinase activity.
Product Categories/Family for anti-PCOLCE antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 47kDa
Observed: 48kDa
NCBI Official Full Name
procollagen C-endopeptidase enhancer 1
NCBI Official Synonym Full Names
procollagen C-endopeptidase enhancer
NCBI Official Symbol
PCOLCE
NCBI Official Synonym Symbols
PCPE; PCPE1; PCPE-1
NCBI Protein Information
procollagen C-endopeptidase enhancer 1
UniProt Protein Name
Procollagen C-endopeptidase enhancer 1
UniProt Gene Name
PCOLCE
UniProt Synonym Gene Names
PCPE1; PCPE-1; Procollagen C-proteinase enhancer 1

NCBI Description

Fibrillar collagen types I-III are synthesized as precursor molecules known as procollagens. These precursors contain amino- and carboxyl-terminal peptide extensions known as N- and C-propeptides, respectively, which are cleaved, upon secretion of procollagen from the cell, to yield the mature triple helical, highly structured fibrils. This gene encodes a glycoprotein which binds and drives the enzymatic cleavage of type I procollagen and heightens C-proteinase activity. [provided by RefSeq, Jul 2008]

Uniprot Description

Binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.

Research Articles on PCOLCE

Similar Products

Product Notes

The PCOLCE pcolce (Catalog #AAA9135284) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PCOLCE Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCOLCE can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:200 - 1:2000. Researchers should empirically determine the suitability of the PCOLCE pcolce for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LTTPNWPESD YPPGISCSWH IIAPPDQVIA LTFEKFDLEP DTYCRYDSVS VFNGAVSDDS RRLGKFCGDA VPGSISSEGN ELLVQFVSDL SVTADGFSAS YKTLPRGTAK EGQGPGPKRG TEPKVKLPPK SQPPEKTEES PSAPDAPTCP KQCRRTGTLQ SNFCASSLVV TATVKSMVRE PGEGLAVTVS LIGAYKTGGL DLPSPPTGAS LKFYVPCKQC PPMKKGVSYL LMGQVEENRG PVLPPESFVV LHRPN. It is sometimes possible for the material contained within the vial of "PCOLCE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.