Serine/threonine-protein kinase PAK 1 Recombinant Protein | PAK1 recombinant protein

Recombinant Human Serine/threonine-protein kinase PAK 1

Cat. Num. AAA1467079

• Gene Names: PAK1; PAKalpha
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Serine/threonine-protein kinase PAK 1; Recombinant Human Serine/threonine-protein kinase PAK 1; Alpha-PAKp21-activated kinase 1; PAK-1p65-PAK; PAK1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-545aa; Full Length
• Sequence: MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH
• Sequence Length: 545

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for PAK1 recombinant protein

Protein kinase involved in intracellular signaling pathways downstream of integrins and receptor-type kinases that plays an important role in cytoskeleton dynamics, in cell adhesion, migration, proliferation, apoptosis, mitosis, and in vesicle-mediated transport processes. Can directly phosphorylate BAD and protects cells against apoptosis. Activated by interaction with CDC42 and RAC1. Functions as GTPase effector that links the Rho-related GTPases CDC42 and RAC1 to the JNK MAP kinase pathway. Phosphorylates and activates MAP2K1, and thereby mediates activation of downstream MAP kinases. Involved in the reorganization of the actin cytoskeleton, actin stress fibers and of focal adhesion complexes. Phosphorylates the tubulin chaperone TBCB and thereby plays a role in the regulation of microtubule biogenesis and organization of the tubulin cytoskeleton. Plays a role in the regulation of insulin secretion in response to elevated glucose levels. Part of a ternary complex that contains PAK1, DVL1 and MUSK that is important for MUSK-dependent regulation of AChR clustering during the formation of the neuromuscular junction (NMJ). Activity is inhibited in cells undergoing apoptosis, potentially due to binding of CDC2L1 and CDC2L2. Phosphorylates MYL9/MLC2. Phosphorylates RAF1 at 'Ser-338' and 'Ser-339' resulting in: activation of RAF1, stimulation of RAF1 translocation to mitochondria, phosphorylation of BAD by RAF1, and RAF1 binding to BCL2. Phosphorylates SNAI1 at 'Ser-246' promoting its transcriptional repressor activity by increasing its accumulation in the nucleus. In podocytes, promotes NR3C2 nuclear localization. Required for atypical chokine receptor ACKR2-induced phosphorylation of LIMK1 and cofilin (CFL1) and for the up-regulation of ACKR2 from endosomal compartment to cell membrane, increasing its efficiency in chokine uptake and degradation. In synapses, ses to mediate the regulation of F-actin cluster formation performed by SHANK3, maybe through CFL1 phosphorylation and inactivation

Product Categories/Family for PAK1 recombinant protein

Apoptosis

References

Human Ste20 homologue hPAK1 links GTPases to the JNK MAP kinase pathway.Brown J.L., Stowers L., Baer M., Trejo J., Coughlin S., Chant J.Curr. Biol. 6:598-605(1996) Human p21-activated kinase (Pak1)regulates actin organization in mammalian cells.Sells M.A., Knaus U.G., Bagrodia S., Ambrose D.M., Bokoch G.M., Chernoff J.Curr. Biol. 7:202-210(1997) Human PAK1B.Reid T., Aspenstroem P., Bertoglio J.Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006) Pak1 phosphorylation of snail, a master regulator of epithelial-to-mesenchyme transition, modulates snail's subcellular localization and functions.Yang Z., Rayala S., Nguyen D., Vadlamudi R.K., Chen S., Kumar R.Cancer Res. 65:3179-3184(2005) Integrin engagement differentially modulates epithelial cell motility by RhoA/ROCK and PAK1.Zhou H., Kramer R.H.J. Biol. Chem. 280:10624-10635(2005) Essential role of CIB1 in regulating PAK1 activation and cell migration.Leisner T.M., Liu M., Jaffer Z.M., Chernoff J., Parise L.V.J. Cell Biol. 170:465-476(2005) p21-activated kinase 1 regulates microtubule dynamics by phosphorylating tubulin cofactor B.Vadlamudi R.K., Barnes C.J., Rayala S., Li F., Balasenthil S., Marcus S., Goodson H.V., Sahin A.A., Kumar R.Mol. Cell. Biol. 25:3726-3736(2005) A probability-based approach for high-throughput protein phosphorylation analysis and site localization.Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.Nat. Biotechnol. 24:1285-1292(2006) CRIPak, a novel endogenous Pak1 inhibitor.Talukder A.H., Meng Q., Kumar R.Oncogene 25:1311-1319(2006) JAK2 tyrosine kinase phosphorylates PAK1 and regulates PAK1 activity and functions.Rider L., Shatrova A., Feener E.P., Webb L., Diakonova M.J. Biol. Chem. 282:30985-30996(2007) Identification of phosphorylation sites in betaPIX and PAK1.Mayhew M.W., Jeffery E.D., Sherman N.E., Nelson K., Polefrone J.M., Pratt S.J., Shabanowitz J., Parsons J.T., Fox J.W., Hunt D.F., Horwitz A.F.J. Cell Sci. 120:3911-3918(2007) Affixin activates Rac1 via betaPIX in C2C12 myoblast.Matsuda C., Kameyama K., Suzuki A., Mishima W., Yamaji S., Okamoto H., Nishino I., Hayashi Y.K.FEBS Lett. 582:1189-1196(2008) Scrib regulates PAK activity during the cell migration process.Nola S., Sebbagh M., Marchetto S., Osmani N., Nourry C., Audebert S., Navarro C., Rachel R., Montcouquiol M., Sans N., Etienne-Manneville S., Borg J.-P., Santoni M.-J.Hum. Mol. Genet. 17:3552-3565(2008) A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.Anal. Chem. 81:4493-4501(2009) Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.Sci. Signal. 2:RA46-RA46(2009) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)

NCBI and Uniprot Product Information

• NCBI GI #: 190886457
• NCBI GeneID: 5058
• NCBI Accession #: NP_001122092.1
• NCBI GenBank Nucleotide #: NM_001128620.1
• UniProt Accession #: Q13153; O75561; Q13567; Q32M53; Q32M54; Q86W79
• Molecular Weight: 76.6 kDa
• NCBI Official Full Name: serine/threonine-protein kinase PAK 1 isoform 1
• NCBI Official Synonym Full Names: p21 protein (Cdc42/Rac)-activated kinase 1
• NCBI Official Symbol: PAK1
• NCBI Official Synonym Symbols: PAKalpha
• NCBI Protein Information: serine/threonine-protein kinase PAK 1
• UniProt Protein Name: Serine/threonine-protein kinase PAK 1
• Protein Family: Serine/threonine-protein kinase
• UniProt Gene Name: PAK1
• UniProt Synonym Gene Names: PAK-1
• UniProt Entry Name: PAK1_HUMAN

NCBI Description

This gene encodes a family member of serine/threonine p21-activating kinases, known as PAK proteins. These proteins are critical effectors that link RhoGTPases to cytoskeleton reorganization and nuclear signaling, and they serve as targets for the small GTP binding proteins Cdc42 and Rac. This specific family member regulates cell motility and morphology. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2010]

Uniprot Description

PAK1: a protein kinase of the STE20 family that regulates cell motility and morphology. Critical RhoGTPase effector that regulates cytoskeleton reorganization, the JNK MAPK pathway, and nuclear signaling. Binding of Rac/cdc42 to the PBD of PAK1 causes autophosphorylation and conformational change. Phosphorylated and activated by PDK.

Protein type: Protein kinase, Ser/Thr (non-receptor); Protein kinase, STE; EC 2.7.11.1; Kinase, protein; STE group; STE20 family; PAKA subfamily

Chromosomal Location of Human Ortholog: 11q13-q14

Cellular Component: axon; cytoplasm; cytosol; dendrite; filamentous actin; focal adhesion; Golgi apparatus; growth cone; intercellular junction; nuclear membrane; plasma membrane; protein complex; ruffle; Z disc

Molecular Function: ATP binding; collagen binding; protein binding; protein kinase activity; protein kinase binding; protein serine/threonine kinase activity; Rac GTPase binding

Biological Process: actin cytoskeleton reorganization; activation of protein kinase activity; amygdala development; apoptosis; axon guidance; branching morphogenesis of a tube; cell migration; cellular response to insulin stimulus; ephrin receptor signaling pathway; exocytosis; innate immune response; MAPKKK cascade; neurite morphogenesis; neuromuscular junction development; positive regulation of cell migration; positive regulation of estrogen receptor signaling pathway; positive regulation of JNK activity; positive regulation of peptidyl-serine phosphorylation; positive regulation of protein amino acid phosphorylation; positive regulation of stress fiber formation; protein amino acid autophosphorylation; protein amino acid phosphorylation; receptor clustering; regulation of apoptosis; regulation of gene expression; regulation of mitotic cell cycle; response to hypoxia; Rho protein signal transduction; small GTPase mediated signal transduction; stimulatory C-type lectin receptor signaling pathway; stress-activated protein kinase signaling pathway; T cell costimulation; T cell receptor signaling pathway; vascular endothelial growth factor receptor signaling pathway; wound healing