Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human GCLC Monoclonal Antibody | anti-GCLC antibody

GCLC (Glutamate-cysteine Ligase Catalytic Subunit, GCL, GLCL, GLCLC, Gamma-glutamylcysteine Synthetase, Gamma-ECS, GCS Heavy Chain) (AP)

Gene Names
GCLC; GCL; GCS; GLCL; GLCLC
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GCLC; Monoclonal Antibody; GCLC (Glutamate-cysteine Ligase Catalytic Subunit; GCL; GLCL; GLCLC; Gamma-glutamylcysteine Synthetase; Gamma-ECS; GCS Heavy Chain) (AP); anti-GCLC antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3H1
Specificity
Recognizes human GCLC.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-GCLC antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa528-637 from human GCLC (NP_001489) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EGVFPGLIPILNSYLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(GCLC monoclonal antibody, Western Blot analysis of GCLC expression in A-431.)

Western Blot (WB) (GCLC monoclonal antibody, Western Blot analysis of GCLC expression in A-431.)

Western Blot (WB)

(Western Blot analysis of GCLC expression in transfected 293T cell line by GCLC monoclonal antibody. Lane 1: GCLC transfected lysate (72.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GCLC expression in transfected 293T cell line by GCLC monoclonal antibody. Lane 1: GCLC transfected lysate (72.8kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GCLC on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to GCLC on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged GCLC is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GCLC is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-GCLC antibody
References
1. Protection against 2-chloroethyl ethyl sulfide (CEES) - Induced cytotoxicity in human keratinocytes by an inducer of the glutathione detoxification pathway. Abel EL, Bubel JD, Simper MS, Powell L, McClellan SA, Andreeff M, Macleod MC, Digiovanni J.Toxicol Appl Pharmacol. 2011 Jun 23. 2. Diversity in Antioxidant Response Enzymes in Progressive Stages of Human Nonalcoholic Fatty Liver Disease. Hardwick RN, Fisher CD, Canet MJ, Lake AD, Cherrington NJ.Drug Metab Dispos. 2010 Dec;38(12):2293-301. Epub 2010 Aug 30.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
glutamate--cysteine ligase catalytic subunit isoform a
NCBI Official Synonym Full Names
glutamate-cysteine ligase catalytic subunit
NCBI Official Symbol
GCLC
NCBI Official Synonym Symbols
GCL; GCS; GLCL; GLCLC
NCBI Protein Information
glutamate--cysteine ligase catalytic subunit
UniProt Protein Name
Glutamate--cysteine ligase catalytic subunit
UniProt Gene Name
GCLC
UniProt Synonym Gene Names
GLCL; GLCLC
UniProt Entry Name
GSH1_HUMAN

NCBI Description

Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate-limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. This locus encodes the catalytic subunit, while the regulatory subunit is derived from a different gene located on chromosome 1p22-p21. Mutations at this locus have been associated with hemolytic anemia due to deficiency of gamma-glutamylcysteine synthetase and susceptibility to myocardial infarction.[provided by RefSeq, Oct 2010]

Uniprot Description

GCLC: Defects in GCLC are the cause of hemolytic anemia (HAGGSD). Belongs to the glutamate--cysteine ligase type 3 family.

Protein type: EC 6.3.2.2; Other Amino Acids Metabolism - glutathione; Ligase

Chromosomal Location of Human Ortholog: 6p12

Cellular Component: glutamate-cysteine ligase complex; cytosol

Molecular Function: glutamate binding; protein heterodimerization activity; glutamate-cysteine ligase activity; magnesium ion binding; ADP binding; coenzyme binding; ATP binding

Biological Process: glutamate metabolic process; response to arsenic; L-ascorbic acid metabolic process; response to hormone stimulus; response to nitrosative stress; cysteine metabolic process; apoptotic mitochondrial changes; response to heat; sulfur amino acid metabolic process; cell redox homeostasis; xenobiotic metabolic process; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; glutathione biosynthetic process; negative regulation of protein ubiquitination; negative regulation of neuron apoptosis; response to oxidative stress; regulation of blood vessel size; negative regulation of transcription, DNA-dependent; regulation of mitochondrial depolarization; negative regulation of apoptosis

Disease: Gamma-glutamylcysteine Synthetase Deficiency, Hemolytic Anemia Due To; Myocardial Infarction, Susceptibility To

Research Articles on GCLC

Similar Products

Product Notes

The GCLC gclc (Catalog #AAA6131440) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GCLC (Glutamate-cysteine Ligase Catalytic Subunit, GCL, GLCL, GLCLC, Gamma-glutamylcysteine Synthetase, Gamma-ECS, GCS Heavy Chain) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GCLC can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GCLC gclc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GCLC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.