Putative olfactory receptor 2W5 (OR2W5) Recombinant Protein | OR2W5 recombinant protein

Recombinant Human Putative olfactory receptor 2W5 (OR2W5)

• Gene Names: OR2W5; OR2W5P; OST722
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Putative olfactory receptor 2W5 (OR2W5); Recombinant Human Putative olfactory receptor 2W5 (OR2W5); Recombinant Putative olfactory receptor 2W5 (OR2W5); Putative olfactory receptor 2W5; OR2W5 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-320
• Sequence: MGKDNASYLQAFILVGSSDRPGLEKILFAVILIFCILTLVGNTAIILLLVMDVRLHTPMYFFLGNLSFLDLCFTASIAPQLLWNLGGPEKTITYHGCVAQLYIYMMLGSTECVLLVVMSHDRYVAVCRSLHYMAVMRPHLCLQLVTVAWCCGFLNSFIMCPQTMQLSRCGRRRVDHFLCEMPALIAMSCEETMLVEAIHLCPGGGSPPGAALPHPHLLWRDCSRGAEDEVSSRAKESLPHLLFSPHSGLSLLRNHHLRVPEAGQQLLPRSGEVPDSLLHHRHSQHQPPHLHFEEQGCEGDHEETSGVGERGWGASTRGTL
• Sequence Length: 320

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 52317225
• NCBI GeneID: 441932
• NCBI Accession #: NP_001004698.1
• NCBI GenBank Nucleotide #: NM_001004698.2
• UniProt Accession #: A6NFC9; B9EH85
• Molecular Weight: 35,528 Da
• NCBI Official Full Name: putative olfactory receptor 2W5
• NCBI Official Synonym Full Names: olfactory receptor, family 2, subfamily W, member 5
• NCBI Official Symbol: OR2W5
• NCBI Official Synonym Symbols: OR2W5P; OST722
• NCBI Protein Information: putative olfactory receptor 2W5; olfactory receptor, family 2, subfamily W, member 5 pseudogene
• UniProt Protein Name: Putative olfactory receptor 2W5
• Protein Family: Putative olfactory receptor
• UniProt Gene Name: OR2W5
• UniProt Synonym Gene Names: OR2W5P
• UniProt Entry Name: OR2W5_HUMAN

NCBI Description

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. This olfactory receptor gene has a coding sequence that is comparable in length to other olfactory receptor genes, but it should be noted that a frameshift is present in the 3' coding region that disrupts the 7-transmembrane domain structure in the protein. It is unclear if the protein can function as an olfactory receptor or if an alternate function is served. For this reason, this gene has also been interpreted to be a pseudogene. [provided by RefSeq, Jan 2010]

Uniprot Description

OR2W5: Odorant receptor (Potential). Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 1q44

Cellular Component: plasma membrane; integral to membrane

Molecular Function: G-protein coupled receptor activity; olfactory receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; detection of chemical stimulus involved in sensory perception of smell