Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Putative olfactory receptor 2W5 (OR2W5) Recombinant Protein | OR2W5 recombinant protein

Recombinant Human Putative olfactory receptor 2W5 (OR2W5)

Gene Names
OR2W5; OR2W5P; OST722
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative olfactory receptor 2W5 (OR2W5); Recombinant Human Putative olfactory receptor 2W5 (OR2W5); OR2W5 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-320aa; Full length protein
Sequence
MGKDNASYLQAFILVGSSDRPGLEKILFAVILIFCILTLVGNTAIILLLVMDVRLHTPMY FFLGNLSFLDLCFTASIAPQLLWNLGGPEKTITYHGCVAQLYIYMMLGSTECVLLVVMSH DRYVAVCRSLHYMAVMRPHLCLQLVTVAWCCGFLNSFIMCPQTMQLSRCGRRRVDHFLCE MPALIAMSCEETMLVEAIHLCPGGGSPPGAALPHPHLLWRDCSRGAEDEVSSRAKESLPH LLFSPHSGLSLLRNHHLRVPEAGQQLLPRSGEVPDSLLHHRHSQHQPPHLHFEEQGCEGD HEETSGVGERGWGASTRGTL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for OR2W5 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,528 Da
NCBI Official Full Name
putative olfactory receptor 2W5
NCBI Official Synonym Full Names
olfactory receptor family 2 subfamily W member 5 (gene/pseudogene)
NCBI Official Symbol
OR2W5
NCBI Official Synonym Symbols
OR2W5P; OST722
NCBI Protein Information
putative olfactory receptor 2W5
UniProt Protein Name
Putative olfactory receptor 2W5
UniProt Gene Name
OR2W5
UniProt Synonym Gene Names
OR2W5P
UniProt Entry Name
OR2W5_HUMAN

NCBI Description

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. This olfactory receptor gene has a coding sequence that is comparable in length to other olfactory receptor genes, but it should be noted that a frameshift is present in the 3' coding region that disrupts the 7-transmembrane domain structure in the protein. It is unclear if the protein can function as an olfactory receptor or if an alternate function is served. For this reason, this gene has also been interpreted to be a pseudogene. [provided by RefSeq, Jan 2010]

Uniprot Description

OR2W5: Odorant receptor (Potential). Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR; GPCR, family 1

Chromosomal Location of Human Ortholog: 1q44

Cellular Component: integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; olfactory receptor activity

Biological Process: detection of chemical stimulus involved in sensory perception of smell; G-protein coupled receptor protein signaling pathway; sensory perception of smell

Similar Products

Product Notes

The OR2W5 or2w5 (Catalog #AAA7024843) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-320aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the OR2W5 or2w5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGKDNASYLQ AFILVGSSDR PGLEKILFAV ILIFCILTLV GNTAIILLLV MDVRLHTPMY FFLGNLSFLD LCFTASIAPQ LLWNLGGPEK TITYHGCVAQ LYIYMMLGST ECVLLVVMSH DRYVAVCRSL HYMAVMRPHL CLQLVTVAWC CGFLNSFIMC PQTMQLSRCG RRRVDHFLCE MPALIAMSCE ETMLVEAIHL CPGGGSPPGA ALPHPHLLWR DCSRGAEDEV SSRAKESLPH LLFSPHSGLS LLRNHHLRVP EAGQQLLPRS GEVPDSLLHH RHSQHQPPHL HFEEQGCEGD HEETSGVGER GWGASTRGTL. It is sometimes possible for the material contained within the vial of "Putative olfactory receptor 2W5 (OR2W5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.