Nucleoside permease nupG (nupG) Recombinant Protein | nupG recombinant protein
Recombinant Escherichia coli Nucleoside permease nupG (nupG), partial
Gene Names
nupG; ECK2959; JW2932
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nucleoside permease nupG (nupG); Recombinant Escherichia coli Nucleoside permease nupG (nupG); partial; nupG recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-418
Sequence
MNLKLQLKILSFLQFCLWGSWLTTLGSYMFVTLKFDGASIGAVYSSLGIAAVFMPALLGIVADKWLSAKWVYAICHTIGAITLFMAAQVTTPEAMFLVILINSFAYMPTLGLINTISYYRLQNAGMDIVTDFPPIRIWGTIGFIMAMWVVSLSGFELSHMQLYIGAALSAILVLFTLTLPHIPVAKQQANQSWTTLLGLDAFALFKNKRMAIFFIFSMLLGAELQITNMFGNTFLHSFDKDPMFASSFIVQHASIIMSISQISETLFILTIPFFLSRYGIKNVMMISIVAWILRFALFAYGDPTPFGTVLLVLSMIVYGCAFDFFNISGSVFVEKEVSPAIRASAQGMFLMMTNGFGCILGGIVSGKVVEMYTQNGITDWQTVWLIFAGYSVVLAFAFMAMFKYKHVRVPTGTQTVSH
Sequence Length
418
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
46,389 Da
NCBI Official Full Name
nucleoside transporter
NCBI Official Symbol
nupG
NCBI Official Synonym Symbols
ECK2959; JW2932
NCBI Protein Information
nucleoside transporter
UniProt Protein Name
Nucleoside permease NupG
Protein Family
UniProt Gene Name
nupG
NCBI Description
NupG, XapB and YegT are paralogs. [More information is available at EcoGene: EG10664]. NupG is one of two high-affinity nucleoside transporters in Escherichia coli. [More information is available at EcoCyc: EG10664].
Uniprot Description
Broad-specificity transporter of purine and pyrimidine nucleosides. Driven by a proton motive force. Can transport uridine, adenosine, inosine, guanosine, thymidine and cytidine. Can also transport xanthosine, but with a very low affinity.
Research Articles on nupG
Similar Products
Product Notes
The nupG nupg (Catalog #AAA1063511) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-418. The amino acid sequence is listed below: MNLKLQLKIL SFLQFCLWGS WLTTLGSYMF VTLKFDGASI GAVYSSLGIA AVFMPALLGI VADKWLSAKW VYAICHTIGA ITLFMAAQVT TPEAMFLVIL INSFAYMPTL GLINTISYYR LQNAGMDIVT DFPPIRIWGT IGFIMAMWVV SLSGFELSHM QLYIGAALSA ILVLFTLTLP HIPVAKQQAN QSWTTLLGLD AFALFKNKRM AIFFIFSMLL GAELQITNMF GNTFLHSFDK DPMFASSFIV QHASIIMSIS QISETLFILT IPFFLSRYGI KNVMMISIVA WILRFALFAY GDPTPFGTVL LVLSMIVYGC AFDFFNISGS VFVEKEVSPA IRASAQGMFL MMTNGFGCIL GGIVSGKVVE MYTQNGITDW QTVWLIFAGY SVVLAFAFMA MFKYKHVRVP TGTQTVSH. It is sometimes possible for the material contained within the vial of "Nucleoside permease nupG (nupG), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
