Nucleotide-binding oligomerization domain-containing protein 2 (NOD2) Recombinant Protein | NOD2 recombinant protein

Recombinant Bovine Nucleotide-binding oligomerization domain-containing protein 2 (NOD2) , partial

Cat. Num. AAA1320761

• Gene Names: NOD2; CARD15
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Nucleotide-binding oligomerization domain-containing protein 2 (NOD2); Recombinant Bovine Nucleotide-binding oligomerization domain-containing protein 2 (NOD2); partial; NOD2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-191. Partial
• Sequence: MCAQDAFQTQRSQLVELLVSGSLEGFESILDRLLSREVLSWEDYEGLSLVGQPISHLARRLLDTIWNKGTWGCEQLTAAVREAQADSQPPELPSSWDPHSPHPARDLQSHRPAIVRRLYGHVEGVLDLTQQRGFISQYETDEIRRPIFTSSQRARRLLDLATVKANGLAAFLLQCIQELPVPLALPFEDAA

• Species: Bovine
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for NOD2 recombinant protein

This gene is a member of the Nod1
Apaf-1 family and encodes a protein with two caspase recruitment (CARD) domains and six leucine-rich repeats (LRRs). The protein is primarily expressed in the peripheral blood leukocytes. It plays a role in the immune response to intracellular bacterial lipopolysaccharides (LPS) by recognizing the muramyl dipeptide (MDP) derived from them and activating the NFKB protein. Mutations in this gene have been associated with Crohn disease and Blau syndrome.

NCBI and Uniprot Product Information

• NCBI GI #: 50872149
• NCBI GeneID: 444867
• NCBI Accession #: NP_001002889.1
• NCBI GenBank Nucleotide #: NM_001002889.1
• UniProt Accession #: Q6E804
• Molecular Weight: 112,800 Da
• NCBI Official Full Name: nucleotide-binding oligomerization domain-containing protein 2
• NCBI Official Synonym Full Names: nucleotide binding oligomerization domain containing 2
• NCBI Official Symbol: NOD2
• NCBI Official Synonym Symbols: CARD15
• NCBI Protein Information: nucleotide-binding oligomerization domain-containing protein 2
• UniProt Protein Name: Nucleotide-binding oligomerization domain-containing protein 2
• Protein Family: Nucleotide-binding oligomerization domain-containing protein
• UniProt Gene Name: NOD2
• UniProt Synonym Gene Names: CARD15

Uniprot Description

Involved in gastrointestinal immunity. Upon stimulation by muramyl dipeptide (MDP), a fragment of bacterial peptidoglycan, binds the proximal adapter receptor-interacting RIPK2, which recruits ubiquitin ligases as XIAP, BIRC2, BIRC3, INAVA and the LUBAC complex, triggering activation of MAP kinases and activation of NF-kappa-B signaling. This in turn leads to the transcriptional activation of hundreds of genes involved in immune response. Required for MDP-induced NLRP1-dependent CASP1 activation and IL1B release in macrophages. Component of an autophagy-mediated antibacterial pathway together with ATG16L1. Plays also a role in sensing single-stranded RNA (ssRNA) from viruses. Interacts with mitochondrial antiviral signaling/MAVS, leading to activation of interferon regulatory factor-3/IRF3 and expression of type I interferon.