Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

E3 ubiquitin-protein ligase NEDD4 (Nedd4) Recombinant Protein | Nedd4 recombinant protein

Recombinant Rat E3 ubiquitin-protein ligase NEDD4 (Nedd4) , partial

Gene Names
Nedd4; Nedd4a
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase NEDD4 (Nedd4); Recombinant Rat E3 ubiquitin-protein ligase NEDD4 (Nedd4); partial; Nedd4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
214-548. partial
Sequence
DENADQAEELEPGWVVLDQPDAATHLQHPPEPSPLPPGWEERQDVLGRTYYVNHESRTTQWKRPSPEDDLTDDENGDIQLQAHGAFTTRRQISEDVDGPDNHESPENWEIVREDENTIYSGQAVQSPPSGHPDVQVRLAEELDTRLTMYGNPATSQPVTSSNHSSRGGSSQTCIFEEQPTLPVLLPTSSGLPPGWEEKQDDRGRSYYVDHNSKTTTWSKPTMQDDPRSKIPAHLRGKTPVDSNDLGPLPPGWEERTHTDGRVFFINHNIKKTQWEDPRMQNVAITGPAEPYSRDYKRKYEFFRRKLKKQTDIPNKFEMKLRRANILEDSYRRIMG
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
102,395 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase NEDD4
NCBI Official Synonym Full Names
neural precursor cell expressed, developmentally down-regulated 4, E3 ubiquitin protein ligase
NCBI Official Symbol
Nedd4
NCBI Official Synonym Symbols
Nedd4a
NCBI Protein Information
E3 ubiquitin-protein ligase NEDD4
UniProt Protein Name
E3 ubiquitin-protein ligase NEDD4
UniProt Gene Name
Nedd4
UniProt Synonym Gene Names
Nedd4a

NCBI Description

may regulate function of the amiloride-sensitive epithelial sodium channel ENaC [RGD, Feb 2006]

Uniprot Description

E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Specifically ubiquitinates 'Lys-63' in target proteins (). Monoubiquitinates IGF1R at multiple sites, thus leading to receptor internalization and degradation in lysosomes. Ubiquitinates FGFR1, leading to receptor internalization and degradation in lysosomes. Promotes ubiquitination of RAPGEF2. Involved in the pathway leading to the degradation of VEGFR-2/KDFR, independently of its ubiquitin-ligase activity. Is involved in ubiquitination of ERBB4 intracellular domain E4ICD. Part of a signaling complex composed of NEDD4, RAP2A and TNIK which regulates neuronal dendrite extension and arborization during development. Ubiquitinates TNK2 and regulates EGF-induced degradation of EGFR and TNF2 (). Involved in the ubiquitination of ebola virus VP40 protein and this ubiquitination plays a role in facilitating viral budding. Ubiquitinates BRAT1 and this ubiquitination is enhanced in the presence of NDFIP1 ().

Research Articles on Nedd4

Similar Products

Product Notes

The Nedd4 nedd4 (Catalog #AAA1284514) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 214-548. partial. The amino acid sequence is listed below: DENADQAEEL EPGWVVLDQP DAATHLQHPP EPSPLPPGWE ERQDVLGRTY YVNHESRTTQ WKRPSPEDDL TDDENGDIQL QAHGAFTTRR QISEDVDGPD NHESPENWEI VREDENTIYS GQAVQSPPSG HPDVQVRLAE ELDTRLTMYG NPATSQPVTS SNHSSRGGSS QTCIFEEQPT LPVLLPTSSG LPPGWEEKQD DRGRSYYVDH NSKTTTWSKP TMQDDPRSKI PAHLRGKTPV DSNDLGPLPP GWEERTHTDG RVFFINHNIK KTQWEDPRMQ NVAITGPAEP YSRDYKRKYE FFRRKLKKQT DIPNKFEMKL RRANILEDSY RRIMG . It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase NEDD4 (Nedd4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.