NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 Recombinant Protein | NDUFA2 recombinant protein

Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2

Cat. Num. AAA1265167

• Gene Names: NDUFA2; B8; CD14; CIB8
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2; Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2; Complex I-B8; CI-B8NADH-ubiquinone oxidoreductase B8 subunit; NDUFA2 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 4-99aa; Partial
• Sequence: AAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA
• Sequence Length: 76

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for NDUFA2 recombinant protein

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Product Categories/Family for NDUFA2 recombinant protein

Transport

References

Identification and primary structure of five human NADH-ubiquinone oxidoreductase subunits.Ton C., Hwang D.M., Dempsey A.A., Liew C.-C.Biochem. Biophys. Res. Commun. 241:589-594(1997) Iida A., Kondo K., Kitamoto T., Kitamura Y., Mishima C., Osawa K., Nakamura Y. ADBCGF02_ADB Homo sapiens cDNA clone ADBCGF02 5',mRNA sequence.Peng Y., Song H., Huang Q., Huang C., Gu Y., Yang Y., Gao G., Xiao H., Xu X., Li N., Qian B., Liu F., Qu J., Gao X., Cheng Z., Xu Z., Zeng L., Xu S., Gu W., Tu Y., Jia J., Fu G., Ren S., Zhong M., Lu G., Hu R., Chen J., Chen Z., Han Z. Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X., Gu J., Chen S.-J., Chen Z.Genome Res. 10:1546-1560(2000)

NCBI and Uniprot Product Information

• NCBI GI #: 297206774
• NCBI GeneID: 4695
• NCBI Accession #: NP_001171941.1
• NCBI GenBank Nucleotide #: NM_001185012.1
• UniProt Accession #: O43678; Q6IAY8; D6RJD6
• Molecular Weight: 37.6 kDa
• NCBI Official Full Name: NADH dehydrogenase
• NCBI Official Synonym Full Names: NADH:ubiquinone oxidoreductase subunit A2
• NCBI Official Symbol: NDUFA2
• NCBI Official Synonym Symbols: B8; CD14; CIB8
• NCBI Protein Information: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
• UniProt Protein Name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
• Protein Family: NADH dehydrogenase
• UniProt Gene Name: NDUFA2
• UniProt Synonym Gene Names: CI-B8
• UniProt Entry Name: NDUA2_HUMAN

NCBI Description

The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex 1), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane, and may be involved in regulating complex I activity or its assembly via assistance in redox processes. Mutations in this gene are associated with Leigh syndrome, an early-onset progressive neurodegenerative disorder. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010]

Uniprot Description

NDUFA2: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Protein type: Energy Metabolism - oxidative phosphorylation; EC 1.6.5.3; Oxidoreductase; Mitochondrial; EC 1.6.99.3

Chromosomal Location of Human Ortholog: 5q31.2

Cellular Component: mitochondrial inner membrane; mitochondrial membrane; mitochondrial respiratory chain complex I

Molecular Function: NADH dehydrogenase (ubiquinone) activity

Biological Process: cellular metabolic process; mitochondrial electron transport, NADH to ubiquinone; mitochondrial respiratory chain complex I assembly

Disease: Leigh Syndrome