Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human NDUFA2 Monoclonal Antibody | anti-NDUFA2 antibody

NDUFA2 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 2, Complex I-B8, CI-B8, NADH-ubiquinone Oxidoreductase B8 Subunit) (HRP)

Gene Names
NDUFA2; B8; CD14; CIB8; MC1DN13
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NDUFA2; Monoclonal Antibody; NDUFA2 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 2; Complex I-B8; CI-B8; NADH-ubiquinone Oxidoreductase B8 Subunit) (HRP); anti-NDUFA2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6E7
Specificity
Recognizes human NDUFA2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-NDUFA2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-99 from human NDUFA2 (NP_002479) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)
Related Product Information for anti-NDUFA2 antibody
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Product Categories/Family for anti-NDUFA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase subunit A2
NCBI Official Symbol
NDUFA2
NCBI Official Synonym Symbols
B8; CD14; CIB8; MC1DN13
NCBI Protein Information
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
UniProt Protein Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
UniProt Gene Name
NDUFA2
UniProt Synonym Gene Names
CI-B8
UniProt Entry Name
NDUA2_HUMAN

NCBI Description

The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex 1), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane, and may be involved in regulating complex I activity or its assembly via assistance in redox processes. Mutations in this gene are associated with Leigh syndrome, an early-onset progressive neurodegenerative disorder. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010]

Uniprot Description

NDUFA2: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Protein type: EC 1.6.99.3; Energy Metabolism - oxidative phosphorylation; EC 1.6.5.3; Oxidoreductase; Mitochondrial

Chromosomal Location of Human Ortholog: 5q31.2

Cellular Component: mitochondrial inner membrane; mitochondrial membrane; mitochondrial respiratory chain complex I

Molecular Function: NADH dehydrogenase (ubiquinone) activity

Biological Process: cellular metabolic process; mitochondrial electron transport, NADH to ubiquinone

Disease: Leigh Syndrome

Research Articles on NDUFA2

Similar Products

Product Notes

The NDUFA2 ndufa2 (Catalog #AAA6153726) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NDUFA2 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 2, Complex I-B8, CI-B8, NADH-ubiquinone Oxidoreductase B8 Subunit) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFA2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NDUFA2 ndufa2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NDUFA2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.