Testing Data
()
CD336 recombinant protein
CD336 Recombinant Protein
Gene Names
NCR2; LY95; CD336; NKP44; NK-p44; dJ149M18.1
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Synonyms
CD336; CD336 Recombinant Protein; CD336 recombinant protein
Host
E Coli
Purity/Purification
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Form/Format
PBS, 4M Urea, PH7.4
Concentration
>=0.5mg/ml (varies by lot)
Sequence
QSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAPIA
Tag
His-tag in C-terminal
Expression Vector
pet-22b(+)
BP
525
Restriction Site
NdeI-XhoI
Preparation and Storage
Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.
Testing Data
()
Testing Data
()
Related Product Information for CD336 recombinant protein
Background: Natural killer (NK) cells direct cytotoxicity against tumor or virally infected cells. NK cell-mediated cytotoxicity is stimulated by several activating receptors associated with the signaling adapter DNAX activation 12/killer cellactivating receptor-associated protein (DAP12). NKp44 is a natural cytotoxicity receptor that is expressed on IL-2-activated human NK cells and may contribute to the increased efficiency of NK cells to mediate tumor cell lysis. NKp44 is composed of one Ig-like extracellular domain, a transmembrane segment and a cytoplasmic domain. Prolactin upregulates and cortisol downregulates the surface expression of NKp44 at the transcriptional level. A cellular ligand for NKp44 (NKp44L) is expressed during HIV-1 infection and is correlated with the progression of CD4+ T cell depletion and an increase of viral load. This implicates NKp44 as a therapeutic agent that may aid in the progress towards a vaccine for HIV-1 infection.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
276
NCBI Official Full Name
Natural cytotoxicity triggering receptor 2
NCBI Official Synonym Full Names
natural cytotoxicity triggering receptor 2
NCBI Official Symbol
NCR2
NCBI Official Synonym Symbols
LY95; CD336; NKP44; NK-p44; dJ149M18.1
NCBI Protein Information
natural cytotoxicity triggering receptor 2; NK cell-activating receptor; NK cell activating receptor (NKp44); natural killer cell p44-related protein; lymphocyte antigen 95 (activating NK-receptor; NK-p44); lymphocyte antigen 95 homolog (activating NK-rec
UniProt Protein Name
Natural cytotoxicity triggering receptor 2
UniProt Gene Name
NCR2
UniProt Synonym Gene Names
LY95; NK-p44; NKp44
UniProt Entry Name
NCTR2_HUMAN
Uniprot Description
NCR2: Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis. Belongs to the natural cytotoxicity receptor (NCR) family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 6p21.1
Cellular Component: integral to plasma membrane; plasma membrane
Molecular Function: transmembrane receptor activity
Biological Process: innate immune response; cellular defense response; signal transduction
Research Articles on CD336
Similar Products
Product Notes
The CD336 ncr2 (Catalog #AAA3004236) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QSKAQVLQSV AGQTLTVRCQ YPPTGSLYEK KGWCKEASAL VCIRLVTSSK PRTMAWTSRF TIWDDPDAGF FTVTMTDLRE EDSGHYWCRI YRPSDNSVSK SVRFYLVVSP ASASTQTSWT PRDLVSSQTQ TQSCVPPTAG ARQAPESPST IPVPSQPQNS TLRPGPAAPI A. It is sometimes possible for the material contained within the vial of "CD336, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
