Myelin transcription factor 1 Recombinant Protein | MYT1 recombinant protein

Recombinant Human Myelin transcription factor 1 protein

Cat. Num. AAA1265434

• Gene Names: MYT1; MTF1; MYTI; NZF2; PLPB1; ZC2HC4A; C20orf36
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Myelin transcription factor 1; Recombinant Human Myelin transcription factor 1 protein; Myelin transcription factor I; MyTI; PLPB1; Proteolipid protein-binding protein; MYT1 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 900-1101aa; Partial
• Sequence: GLGHISGKYASHRSASGCPLAARRQKEGSLNGSSFSWKSLKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRATFAGKKGKLSGDEVLSPKFKTSDVLENDEEIKQLNQEIRDLNESNSEMEAAMVQLQSQISSMEKNLKNIEEENKLIEEQNEALFLELSGLSQALIQSLANIRLPHMEPICEQNFDAYVSTLTDMYSNQ
• Sequence Length: 1,148

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for MYT1 recombinant protein

Binds to the promoter regions of proteolipid proteins of the central nervous system. May play a role in the development of neurons and oligodendrogalia in the CNS. May regulate a critical transition point in oligodendrocyte lineage development by modulating oligodendrocyte progenitor proliferation relative to terminal differentiation and up-regulation of myelin gene transcription.

Product Categories/Family for MYT1 recombinant protein

Developmental Biology

References

Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.DNA Res. 5:355-364(1998) The DNA sequence and comparative analysis of human chromosome 20.Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.Nature 414:865-871(2001)

NCBI and Uniprot Product Information

• NCBI GeneID: 4661
• UniProt Accession #: Q01538; O94922; Q7Z5W2; Q9UPV2; E1P5H0; F5H7M8
• Molecular Weight: 26.1 kDa
• NCBI Official Synonym Full Names: myelin transcription factor 1
• NCBI Official Symbol: MYT1
• NCBI Official Synonym Symbols: MTF1; MYTI; NZF2; PLPB1; ZC2HC4A; C20orf36
• NCBI Protein Information: myelin transcription factor 1
• UniProt Protein Name: Myelin transcription factor 1
• Protein Family: Myelin transcription factor
• UniProt Gene Name: MYT1
• UniProt Synonym Gene Names: KIAA0835; KIAA1050; MTF1; MYTI; PLPB1; MyT1; MyTI
• UniProt Entry Name: MYT1_HUMAN

NCBI Description

The protein encoded by this gene is a member of a family of neural specific, zinc finger-containing DNA-binding proteins. The protein binds to the promoter regions of proteolipid proteins of the central nervous system and plays a role in the developing nervous system. [provided by RefSeq, Jul 2008]

Uniprot Description

PLPB1: Binds to the promoter regions of proteolipid proteins of the central nervous system. May play a role in the development of neurons and oligodendrogalia in the CNS. May regulate a critical transition point in oligodendrocyte lineage development by modulating oligodendrocyte progenitor proliferation relative to terminal differentiation and up-regulation of myelin gene transcription.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 20q13.33

Cellular Component: cytoplasm; nucleoplasm; nucleus

Molecular Function: transcription factor activity; zinc ion binding

Biological Process: cell differentiation; cell glucose homeostasis; endocrine pancreas development; nervous system development; post-embryonic development; regulation of hormone metabolic process; regulation of transcription, DNA-dependent; transcription, DNA-dependent