Western Blot (WB)
(Western Blot detection against Immunogen (36.63kD).)
Mouse anti-Human MYT1 Monoclonal Antibody | anti-MYT1 antibody
MYT1 (Myelin Transcription Factor 1, MyT1, Myelin Transcription Factor I, MyTI, PLPB1, Proteolipid Protein-binding Protein, KIAA0835, KIAA1050, MTF1, MYTI, PLPB1) (PE)
Gene Names
MYT1; MTF1; MYTI; NZF2; PLPB1; ZC2HC4A; C20orf36
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MYT1; Monoclonal Antibody; MYT1 (Myelin Transcription Factor 1; MyT1; Myelin Transcription Factor I; MyTI; PLPB1; Proteolipid Protein-binding Protein; KIAA0835; KIAA1050; MTF1; MYTI; PLPB1) (PE); anti-MYT1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a, lambda
Clone Number
2A7
Specificity
Recognizes human MYT1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-MYT1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa586-685 from human MYT1 (NP_004526) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DYASFDAQVFGKRMLAPKIQTSETSPKAFQCFDYSQDAEAAHMAATAILNLSTRCWEMPENLSTKPQDLPSKSVDIEVDENGTLDLSMHKHRKRENAFPS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.63kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.63kD).)
Related Product Information for anti-MYT1 antibody
MYT1 is a member of a family of neural specific, zinc finger-containing DNA-binding proteins. The protein binds to the promoter regions of proteolipid proteins of the central nervous system and plays a role in the developing nervous system.
Product Categories/Family for anti-MYT1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
125,075 Da
NCBI Official Full Name
myelin transcription factor 1
NCBI Official Synonym Full Names
myelin transcription factor 1
NCBI Official Symbol
MYT1
NCBI Official Synonym Symbols
MTF1; MYTI; NZF2; PLPB1; ZC2HC4A; C20orf36
NCBI Protein Information
myelin transcription factor 1; myelin transcription factor I; neural zinc finger transcription factor 2; proteolipid protein binding protein; proteolipid protein-binding protein
UniProt Protein Name
Myelin transcription factor 1
Protein Family
UniProt Gene Name
MYT1
UniProt Synonym Gene Names
KIAA0835; KIAA1050; MTF1; MYTI; PLPB1; MyT1; MyTI
UniProt Entry Name
MYT1_HUMAN
Uniprot Description
PLPB1: Binds to the promoter regions of proteolipid proteins of the central nervous system. May play a role in the development of neurons and oligodendrogalia in the CNS. May regulate a critical transition point in oligodendrocyte lineage development by modulating oligodendrocyte progenitor proliferation relative to terminal differentiation and up-regulation of myelin gene transcription.
Protein type: Transcription factor; DNA-binding
Chromosomal Location of Human Ortholog: 20q13.33
Cellular Component: nucleoplasm; cytoplasm; nucleus
Molecular Function: zinc ion binding; transcription factor activity
Biological Process: nervous system development; regulation of transcription, DNA-dependent; transcription, DNA-dependent; cell differentiation
Similar Products
Product Notes
The MYT1 myt1 (Catalog #AAA6158986) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MYT1 (Myelin Transcription Factor 1, MyT1, Myelin Transcription Factor I, MyTI, PLPB1, Proteolipid Protein-binding Protein, KIAA0835, KIAA1050, MTF1, MYTI, PLPB1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MYT1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MYT1 myt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MYT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
