Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Myelin transcription factor 1 Recombinant Protein | MYT1 recombinant protein

Recombinant human Myelin transcription factor 1 protein

Gene Names
MYT1; MTF1; MYTI; PLPB1; ZC2HC4A; C20orf36
Applications
SDS-Page, ELISA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Myelin transcription factor 1; Recombinant human Myelin transcription factor 1 protein; Myelin transcription factor I; MYT1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
GLGHISGKYASHRSASGCPLAARRQKEGSLNGSSFSWKSLKNEGPTCPTPGCDGSGHANGSFLTHRSLSGCPRATFAGKKGKLSGDEVLSPKFKTSDVLENDEEIKQLNQEIRDLNESNSEMEAAMVQLQSQISSMEKNLKNIEEENKLIEEQNEALFLELSGLSQALIQSLANIRLPHMEPICEQNFDAYVSTLTDMYSNQ
Applicable Applications for MYT1 recombinant protein
SDS-PAGE, ELISA (EIA)
Preparation and Storage
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for MYT1 recombinant protein
Binds to the promoter regions of proteolipid proteins of the central nervous system. May play a role in the development of neurons and oligodendrogalia in the CNS. May regulate a critical transition point in oligodendrocyte lineage development by modulating oligodendrocyte progenitor proliferation relative to terminal differentiation and up-regulation of myelin gene transcription. Ref.8

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29 kd
NCBI Official Full Name
myelin transcription factor 1
NCBI Official Synonym Full Names
myelin transcription factor 1
NCBI Official Symbol
MYT1
NCBI Official Synonym Symbols
MTF1; MYTI; PLPB1; ZC2HC4A; C20orf36
NCBI Protein Information
myelin transcription factor 1; myelin transcription factor I; proteolipid protein binding protein; proteolipid protein-binding protein
UniProt Protein Name
Myelin transcription factor 1
UniProt Gene Name
MYT1
UniProt Synonym Gene Names
KIAA0835; KIAA1050; MTF1; MYTI; PLPB1; MyT1; MyTI
UniProt Entry Name
MYT1_HUMAN

NCBI Description

The protein encoded by this gene is a member of a family of neural specific, zinc finger-containing DNA-binding proteins. The protein binds to the promoter regions of proteolipid proteins of the central nervous system and plays a role in the developing nervous system. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Binds to the promoter regions of proteolipid proteins of the central nervous system. May play a role in the development of neurons and oligodendrogalia in the CNS. May regulate a critical transition point in oligodendrocyte lineage development by modulating oligodendrocyte progenitor proliferation relative to terminal differentiation and up-regulation of myelin gene transcription. Ref.8

Subunit structure: Interacts with STEAP3. Ref.7

Subcellular location: Nucleus.

Tissue specificity: Mostly in developing nervous system. Expressed in neural progenitors and oligodendrocyte lineage cells. More highly expressed in oligodendrocyte progenitors than in differentiated oligodendrocytes. Ref.6

Domain: Contains 7 zinc fingers of the C2HC class arranged in two widely separated clusters. These two domains of DNA binding can function independently and recognize the same DNA sequence.

Sequence similarities: Contains 7 C2HC-type zinc fingers.

Sequence caution: The sequence BAA74858.2 differs from that shown. Reason: Erroneous initiation.

Research Articles on MYT1

Similar Products

Product Notes

The MYT1 myt1 (Catalog #AAA719386) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Myelin transcription factor 1 can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, ELISA (EIA). Researchers should empirically determine the suitability of the MYT1 myt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GLGHISGKYA SHRSASGCPL AARRQKEGSL NGSSFSWKSL KNEGPTCPTP GCDGSGHANG SFLTHRSLSG CPRATFAGKK GKLSGDEVLS PKFKTSDVLE NDEEIKQLNQ EIRDLNESNS EMEAAMVQLQ SQISSMEKNL KNIEEENKLI EEQNEALFLE LSGLSQALIQ SLANIRLPHM EPICEQNFDA YVSTLTDMYS NQ. It is sometimes possible for the material contained within the vial of "Myelin transcription factor 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.