Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MYL2) Recombinant Protein | MYL2 recombinant protein

Recombinant Bovine Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MYL2)

Gene Names
MYL2; MLC-2s/v
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Myosin regulatory light chain 2; ventricular/cardiac muscle isoform (MYL2); Recombinant Bovine Myosin regulatory light chain 2; MYL2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-166, full length protein
Sequence
SPKKAKKRAEGANYNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMLKEAPGPINFTVFLQMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYIKEMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Sequence Length
165
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for MYL2 recombinant protein
Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,981 Da
NCBI Official Full Name
myosin regulatory light chain 2, ventricular/cardiac muscle isoform
NCBI Official Synonym Full Names
myosin light chain 2
NCBI Official Symbol
MYL2
NCBI Official Synonym Symbols
MLC-2s/v
NCBI Protein Information
myosin regulatory light chain 2, ventricular/cardiac muscle isoform
UniProt Protein Name
Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
Protein Family
UniProt Gene Name
MYL2
UniProt Synonym Gene Names
MLC-2s/v

Uniprot Description

Contractile protein that plays a role in heart development and function (). Following phosphorylation, plays a role in cross-bridge cycling kinetics and cardiac muscle contraction by increasing myosin lever arm stiffness and promoting myosin head diffusion; as a consequence of the increase in maximum contraction force and calcium sensitivity of contraction force. These events altogether slow down myosin kinetics and prolong duty cycle resulting in accumulated myosins being cooperatively recruited to actin binding sites to sustain thin filament activation as a means to fine-tune myofilament calcium sensitivity to force (). During cardiogenesis plays an early role in cardiac contractility by promoting cardiac myofibril assembly ().

Similar Products

Product Notes

The MYL2 myl2 (Catalog #AAA1468895) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-166, full length protein. The amino acid sequence is listed below: SPKKAKKRAE GANYNVFSMF EQTQIQEFKE AFTIMDQNRD GFIDKNDLRD TFAALGRVNV KNEEIDEMLK EAPGPINFTV FLQMFGEKLK GADPEETILN AFKVFDPEGK GVLKADYIKE MLTTQAERFS KEEIDQMFAA FPPDVTGNLD YKNLVHIITH GEEKD. It is sometimes possible for the material contained within the vial of "Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MYL2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.