Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MYL2Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human MYL2 Polyclonal Antibody | anti-MYL2 antibody

MYL2 Antibody - middle region

Gene Names
MYL2; MLC2; CMH10; MLC-2s/v
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MYL2; Polyclonal Antibody; MYL2 Antibody - middle region; anti-MYL2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: APKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRD
Sequence Length
166
Applicable Applications for anti-MYL2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MYL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MYL2Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MYL2Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MYL2 antibody
Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy.
Product Categories/Family for anti-MYL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19 kDa
NCBI Official Full Name
myosin regulatory light chain 2, ventricular/cardiac muscle isoform
NCBI Official Synonym Full Names
myosin light chain 2
NCBI Official Symbol
MYL2
NCBI Official Synonym Symbols
MLC2; CMH10; MLC-2s/v
NCBI Protein Information
myosin regulatory light chain 2, ventricular/cardiac muscle isoform
UniProt Protein Name
Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
Protein Family
UniProt Gene Name
MYL2
UniProt Synonym Gene Names
MLC-2; MLC-2v
UniProt Entry Name
MLRV_HUMAN

NCBI Description

Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008]

Uniprot Description

MRLC2V: myosin regulatory light chain 2, ventricular/cardiac muscle isoform. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in MYL2 are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy.

Protein type: Contractile

Chromosomal Location of Human Ortholog: 12q24.11

Cellular Component: sarcomere; cytoskeleton; myofibril; myosin complex; cytosol; A band; actin cytoskeleton

Molecular Function: actin monomer binding; protein binding; structural constituent of muscle; calcium ion binding; myosin heavy chain binding

Biological Process: muscle cell fate specification; heart contraction; regulation of striated muscle contraction; ventricular cardiac muscle morphogenesis; cardiac myofibril assembly; negative regulation of cell growth; muscle fiber development; post-embryonic development; muscle filament sliding; cardiac muscle contraction

Disease: Cardiomyopathy, Familial Hypertrophic, 10

Research Articles on MYL2

Similar Products

Product Notes

The MYL2 myl2 (Catalog #AAA3220842) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYL2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MYL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MYL2 myl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: APKKAKKRAG GANSNVFSMF EQTQIQEFKE AFTIMDQNRD GFIDKNDLRD. It is sometimes possible for the material contained within the vial of "MYL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.