Mouse anti-Human MYL2 Monoclonal Antibody | anti-MYL2 antibody

MYL2 (Myosin Regulatory Light Chain 2, Ventricular/Cardiac Muscle Isoform, MLC-2, MLC-2v, DKFZp779C0562) (HRP)

Cat. Num. AAA6153658

• Gene Names: MYL2; MLC2; CMH10; MLC-2s/v
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MYL2; Monoclonal Antibody; MYL2 (Myosin Regulatory Light Chain 2; Ventricular/Cardiac Muscle Isoform; MLC-2; MLC-2v; DKFZp779C0562) (HRP); anti-MYL2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3B9-B4
• Specificity: Recognizes human MYL2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-MYL2 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-166 from human MYL2 (AAH15821.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (44kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MYL2 on HeLa cell. [antibody concentration 10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of MYL2 transfected lysate using anti-MYL2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MYL2 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged MYL2 is 0.03ng/ml as a capture antibody.)

Related Product Information for anti-MYL2 antibody

MYL2 encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in MYL2 are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy.

Product Categories/Family for anti-MYL2 antibody

Antibodies; Cardiac Markers

References

1. Drastic increase of myosin light chain MLC-2 in senescent skeletal muscle indicates fast-to-slow fibre transition in sarcopenia of old age. Gannon J, Doran P, Kirwan A, Ohlendieck K.Eur J Cell Biol. 2009 Nov;88(11):685-700. Epub 2009 Jul 19.

NCBI and Uniprot Product Information

• NCBI GI #: 16198354
• NCBI GeneID: 4633
• Molecular Weight: 18,789 Da
• NCBI Official Full Name: Homo sapiens myosin, light chain 2, regulatory, cardiac, slow, mRNA
• NCBI Official Synonym Full Names: myosin light chain 2
• NCBI Official Symbol: MYL2
• NCBI Official Synonym Symbols: MLC2; CMH10; MLC-2s/v
• NCBI Protein Information: myosin regulatory light chain 2, ventricular/cardiac muscle isoform
• Protein Family: Myosin regulatory

NCBI Description

Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008]