Myosin light chain 1/3, skeletal muscle isoform (Myl1) Recombinant Protein | Myl1 recombinant protein
Recombinant Mouse Myosin light chain 1/3, skeletal muscle isoform (Myl1)
Gene Names
Myl1; Mylf; MLC1f; MLC3f; AI325107
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Myosin light chain 1/3; skeletal muscle isoform (Myl1); Recombinant Mouse Myosin light chain 1/3; Myl1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-188, Full length protein
Sequence
APKKDVKKPAAAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQEDFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMMQAISNNKDQGGYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALLAGQEDSNGCINYEAFVKHIMSV
Sequence Length
187
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Myl1 recombinant protein
Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
16,600 Da
NCBI Official Full Name
myosin light chain 1/3, skeletal muscle isoform isoform 3f
NCBI Official Synonym Full Names
myosin, light polypeptide 1
NCBI Official Symbol
Myl1
NCBI Official Synonym Symbols
Mylf; MLC1f; MLC3f; AI325107
NCBI Protein Information
myosin light chain 1/3, skeletal muscle isoform
UniProt Protein Name
Myosin light chain 1/3, skeletal muscle isoform
Protein Family
UniProt Gene Name
Myl1
UniProt Synonym Gene Names
Mylf; MLC1/MLC3; MLC1F/MLC3F; Myosin light chain A1/A2
NCBI Description
Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two non-phosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Multiple transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Uniprot Description
Regulatory light chain of myosin. Does not bind calcium.
Research Articles on Myl1
Similar Products
Product Notes
The Myl1 myl1 (Catalog #AAA963539) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-188, Full length protein. The amino acid sequence is listed below: APKKDVKKPA AAPAPAPAPA PAPAKPKEEK IDLSAIKIEF SKEQQEDFKE AFLLFDRTGE CKITLSQVGD VLRALGTNPT NAEVKKVLGN PSNEEMNAKK IEFEQFLPMM QAISNNKDQG GYEDFVEGLR VFDKEGNGTV MGAELRHVLA TLGEKMKEEE VEALLAGQED SNGCINYEAF VKHIMSV. It is sometimes possible for the material contained within the vial of "Myosin light chain 1/3, skeletal muscle isoform (Myl1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
