Mucin-12 (MUC12) Recombinant Protein | MUC12 recombinant protein

Recombinant Human Mucin-12 (MUC12) , partial

Cat. Num. AAA1294043

• Gene Names: MUC12; MUC11; MUC-11; MUC-12
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Mucin-12 (MUC12); Recombinant Human Mucin-12 (MUC12); partial; MUC12 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 5248-5367. Partial
• Sequence: EELFENLAEIVKAKIMNETRTTLLDPDSCRKAILCYSEEDTFVDSSVTPGFDFQEQCTQKAAEGYTQFYYVDVLDGKLACVNKCTKGTKSQMNCNLGTCQLQRSGPRCLCPNTNTHWYWG

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 256600257
• NCBI GeneID: 10071
• NCBI Accession #: NP_001157934.1
• NCBI GenBank Nucleotide #: NM_001164462.1
• UniProt Accession #: Q9UKN1; Q9UKN0; A6ND38; F5GWV9
• Molecular Weight: 542,703 Da
• NCBI Official Full Name: mucin-12
• NCBI Official Synonym Full Names: mucin 12, cell surface associated
• NCBI Official Symbol: MUC12
• NCBI Official Synonym Symbols: MUC11; MUC-11; MUC-12
• NCBI Protein Information: mucin-12
• UniProt Protein Name: Mucin-12
• Protein Family: Mucin
• UniProt Gene Name: MUC12
• UniProt Synonym Gene Names: MUC11; MUC-12; MUC-11

NCBI Description

This gene encodes an integral membrane glycoprotein that is a member of the mucin family. Mucins are O-glycosylated proteins that play an essential role in forming protective mucous barriers on epithelial surfaces and have been implicated in epithelial renewal and differentiation. These glycoproteins also play a role in intracellular signaling. This protein is expressed on the apical membrane surface of epithelial cells that line the mucosal surfaces of many different tissues including the colon, pancreas, prostate, and uterus. The expression of this gene is downregulated in colorectal cancer tissue. [provided by RefSeq, Apr 2017]

Uniprot Description

Involved in epithelial cell protection, adhesion modulation, and signaling. May be involved in epithelial cell growth regulation. Stimulated by both cytokine TNF-alpha and TGF-beta in intestinal epithelium.