Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (LSAMP antibody (MBS5302274) used at 1 ug/ml to detect target protein.)

Rabbit LSAMP Polyclonal Antibody | anti-LSAMP antibody

LSAMP antibody

Gene Names
LSAMP; LAMP; IGLON3
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
LSAMP; Polyclonal Antibody; LSAMP antibody; Polyclonal LSAMP; Anti-LSAMP; Limbic System-Associated Membrane Protein; LAMP; anti-LSAMP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
LSAMP antibody was raised against the N terminal of LSAMP
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LSAMP antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
338
Applicable Applications for anti-LSAMP antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
LSAMP is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
LSAMP antibody was raised using the N terminal of LSAMP corresponding to a region with amino acids MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAI
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(LSAMP antibody (MBS5302274) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (LSAMP antibody (MBS5302274) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-LSAMP antibody
Rabbit polyclonal LSAMP antibody raised against the N terminal of LSAMP
Product Categories/Family for anti-LSAMP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37 kDa (MW of target protein)
NCBI Official Full Name
limbic system-associated membrane protein preproprotein
NCBI Official Synonym Full Names
limbic system-associated membrane protein
NCBI Official Symbol
LSAMP
NCBI Official Synonym Symbols
LAMP; IGLON3
NCBI Protein Information
limbic system-associated membrane protein
UniProt Protein Name
Limbic system-associated membrane protein
UniProt Gene Name
LSAMP
UniProt Synonym Gene Names
IGLON3; LAMP; LSAMP
UniProt Entry Name
LSAMP_HUMAN

NCBI Description

The protein encoded by this gene is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this encoded protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections. [provided by RefSeq, Jul 2008]

Uniprot Description

LSAMP: Mediates selective neuronal growth and axon targeting. Contributes to the guidance of developing axons and remodeling of mature circuits in the limbic system. Essential for normal growth of the hyppocampal mossy fiber projection. Belongs to the immunoglobulin superfamily. IgLON family.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 3q13.2-q21

Cellular Component: neuron projection; cell surface; cell soma; plasma membrane; intercellular junction

Molecular Function: protein binding

Biological Process: nervous system development; cell-cell adhesion; regulation of neurogenesis

Research Articles on LSAMP

Similar Products

Product Notes

The LSAMP lsamp (Catalog #AAA5302274) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LSAMP antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LSAMP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the LSAMP lsamp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LSAMP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.