Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cytochrome b (MT-CYB) Recombinant Protein | MT-CYB recombinant protein

Recombinant Lepus alleni Cytochrome b (MT-CYB)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome b (MT-CYB); Recombinant Lepus alleni Cytochrome b (MT-CYB); Recombinant Cytochrome b (MT-CYB); Cytochrome b; Complex III subunit 3 Complex III subunit III Cytochrome b-c1 complex subunit 3 Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; MT-CYB recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-234
Sequence
MTNIRKTHPLLKIVNHSLIDLPAPSNISAWWNFGSLLGLCLMIQILTGLFLAMHYTSDTATAFSSVTHICRDVNYGWLIRYLHANGASMFFICLYMHVGRGIYYGSYTYLETWNIGIILLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALVMIHLLFLHETGSNNPSGIPSDSDKIPFHPYYTIKDVLGFLM
Sequence Length
234
Species
Lepus alleni (Antelope jackrabbit)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
26,409 Da
NCBI Official Full Name
Cytochrome b
UniProt Protein Name
Cytochrome b
UniProt Gene Name
MT-CYB
UniProt Synonym Gene Names
COB; CYTB; MTCYB
UniProt Entry Name
CYB_LEPAL

Uniprot Description

Function: Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis

By similarity.

Cofactor: Binds 2 heme groups non-covalently

By similarity.

Subunit structure: The bc1 complex contains 11 subunits: 3 respiratory subunits (cytochrome b, cytochrome c1 and Rieske/UQCRFS1), 2 core proteins (UQCRC1/QCR1 and UQCRC2/QCR2) and 6 low-molecular weight proteins (UQCRH/QCR6, UQCRB/QCR7, UQCRQ/QCR8, UQCR10/QCR9, UQCR11/QCR10 and a cleavage product of Rieske/UQCRFS1)

By similarity.

Subcellular location: Mitochondrion inner membrane; Multi-pass membrane protein

By similarity.

Miscellaneous: Heme 1 (or BL or b562) is low-potential and absorbs at about 562 nm, and heme 2 (or BH or b566) is high-potential and absorbs at about 566 nm

By similarity.

Sequence similarities: Belongs to the cytochrome b family.

Similar Products

Product Notes

The Cytochrome b (MT-CYB) mt-cyb (Catalog #AAA1238792) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-234. The amino acid sequence is listed below: MTNIRKTHPL LKIVNHSLID LPAPSNISAW WNFGSLLGLC LMIQILTGLF LAMHYTSDTA TAFSSVTHIC RDVNYGWLIR YLHANGASMF FICLYMHVGR GIYYGSYTYL ETWNIGIILL FAVMATAFMG YVLPWGQMSF WGATVITNLL SAIPYIGTTL VEWIWGGFSV DKATLTRFFA FHFILPFIIA ALVMIHLLFL HETGSNNPSG IPSDSDKIPF HPYYTIKDVL GFLM. It is sometimes possible for the material contained within the vial of "Cytochrome b (MT-CYB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.