Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Major histocompatibility complex class I-related gene protein (MR1) Recombinant Protein | MR1 recombinant protein

Recombinant Human Major histocompatibility complex class I-related gene protein (MR1), partial

Gene Names
MR1; HLALS
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Major histocompatibility complex class I-related gene protein (MR1); Recombinant Human Major histocompatibility complex class I-related gene protein (MR1); partial; MR1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-302aa; Extracellular domain
Sequence
RTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELDPQSSNLYSCHVEHCGVHMVLQVPQESETIPLVM
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25,190 Da
NCBI Official Full Name
major histocompatibility complex class I-related gene protein isoform 2
NCBI Official Synonym Full Names
major histocompatibility complex, class I-related
NCBI Official Symbol
MR1
NCBI Official Synonym Symbols
HLALS
NCBI Protein Information
major histocompatibility complex class I-related gene protein
UniProt Protein Name
Major histocompatibility complex class I-related gene protein
UniProt Gene Name
MR1
UniProt Synonym Gene Names
MHC class I-related gene protein

NCBI Description

MAIT (mucosal-associated invariant T-cells) lymphocytes represent a small population of T-cells primarily found in the gut. The protein encoded by this gene is an antigen-presenting molecule that presents metabolites of microbial vitamin B to MAITs. This presentation may activate the MAITs to regulate the amounts of specific types of bacteria in the gut. Several transcript variants encoding different isoforms have been found for this gene, and a pseudogene of it has been detected about 36 kbp upstream on the same chromosome. [provided by RefSeq, Jul 2015]

Uniprot Description

Antigen-presenting molecule specialized in presenting microbial vitamin B metabolites. Involved in the development and expansion of a small population of T-cells expressing an invariant T-cell receptor alpha chain called mucosal-associated invariant T-cells (MAIT). MAIT lymphocytes are preferentially located in the gut lamina propria and therefore may be involved in monitoring commensal flora or serve as a distress signal. Expression and MAIT cell recognition seem to be ligand-dependent.

Research Articles on MR1

Similar Products

Product Notes

The MR1 mr1 (Catalog #AAA1366501) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-302aa; Extracellular domain. The amino acid sequence is listed below: RTHSLRYFRL GVSDPIHGVP EFISVGYVDS HPITTYDSVT RQKEPRAPWM AENLAPDHWE RYTQLLRGWQ QMFKVELKRL QRHYNHSGSH TYQRMIGCEL LEDGSTTGFL QYAYDGQDFL IFNKDTLSWL AVDNVAHTIK QAWEANQHEL LYQKNWLEEE CIAWLKRFLE YGKDTLQRTE PPLVRVNRKE TFPGVTALFC KAHGFYPPEI YMTWMKNGEE IVQEIDYGDI LPSGDGTYQA WASIELDPQS SNLYSCHVEH CGVHMVLQVP QESETIPLVM . It is sometimes possible for the material contained within the vial of "Major histocompatibility complex class I-related gene protein (MR1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.