Western Blot (WB)
(WB Suggested Anti-GANAB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateGANAB is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Rabbit GANAB Polyclonal Antibody | anti-GANAB antibody
GANAB antibody - middle region
Gene Names
GANAB; G2AN; GIIA; PKD3; GLUII
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GANAB; Polyclonal Antibody; GANAB antibody - middle region; anti-GANAB antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHL
Sequence Length
944
Applicable Applications for anti-GANAB antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 91%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GANAB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-GANAB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateGANAB is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Western Blot (WB)
(WB Suggested Anti-GANAB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateGANAB is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-GANAB antibody
This is a rabbit polyclonal antibody against GANAB. It was validated on Western Blot
Target Description: GANAB cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc2Man9GlcNAc2 oligosaccharide precursor of immature glycoproteins.
Target Description: GANAB cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc2Man9GlcNAc2 oligosaccharide precursor of immature glycoproteins.
Product Categories/Family for anti-GANAB antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
107kDa
NCBI Official Full Name
neutral alpha-glucosidase AB isoform 2
NCBI Official Synonym Full Names
glucosidase II alpha subunit
NCBI Official Symbol
GANAB
NCBI Official Synonym Symbols
G2AN; GIIA; PKD3; GLUII
NCBI Protein Information
neutral alpha-glucosidase AB
UniProt Protein Name
Neutral alpha-glucosidase AB
Protein Family
UniProt Gene Name
GANAB
UniProt Synonym Gene Names
G2AN; KIAA0088
UniProt Entry Name
GANAB_HUMAN
NCBI Description
This gene encodes the alpha subunit of glucosidase II and a member of the glycosyl hydrolase 31 family of proteins. The heterodimeric enzyme glucosidase II plays a role in protein folding and quality control by cleaving glucose residues from immature glycoproteins in the endoplasmic reticulum. Expression of the encoded protein is elevated in lung tumor tissue and in response to UV irradiation. Mutations in this gene cause autosomal-dominant polycystic kidney and liver disease. [provided by RefSeq, Jul 2016]
Research Articles on GANAB
Similar Products
Product Notes
The GANAB ganab (Catalog #AAA3212443) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GANAB antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GANAB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GANAB ganab for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IIGAGKPAAV VLQTKGSPES RLSFQHDPET SVLVLRKPGI NVASDWSIHL. It is sometimes possible for the material contained within the vial of "GANAB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
