mRNA interferase MqsR (mqsR) Recombinant Protein | mqsR recombinant protein

Recombinant Escherichia coli mRNA interferase MqsR (mqsR)

Cat. Num. AAA1408497

• Gene Names: mqsR; ECK3013; JW2990; ygiU
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: mRNA interferase MqsR (mqsR); Recombinant Escherichia coli mRNA interferase MqsR (mqsR); mqsR recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-98, full length protein
• Sequence: MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQVYLKITVIHDVLIVSFKEK
• Sequence Length: 98

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 16130918
• NCBI GeneID: 947500
• NCBI Accession #: NP_417494.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: Q46865; Q2M9H8
• Molecular Weight: 11,232 Da
• NCBI Official Full Name: GCU-specific mRNA interferase toxin of the MqsR-MqsA toxin-antitoxin system; biofilm/motility regulator; anti-repressor
• NCBI Official Symbol: mqsR
• NCBI Official Synonym Symbols: ECK3013; JW2990; ygiU
• NCBI Protein Information: GCU-specific mRNA interferase toxin of the MqsR-MqsA toxin-antitoxin system; biofilm/motility regulator; anti-repressor
• UniProt Protein Name: mRNA interferase toxin MqsR
• Protein Family: mRNA interferase
• UniProt Gene Name: mqsR

NCBI Description

msqR is induced during biofilm formation. [More information is available at EcoGene: EG13023]. MqsR is a global regulator that controls biofilm formation by inducing motility via the two-component regulatory system QseBC. [More information is available at EcoCyc: G7572].

Uniprot Description

Toxic component of a type II toxin-antitoxin (TA) system. Plays a significant role in the control of biofilm formation and induction of persister cells in the presence of antibiotics. An mRNA interferase which has been reported to be translation-independent (PubMed:19690171, PubMed:19943910, PubMed:23289863). It has also been reported to be translation-dependent (PubMed:20041169). Cleavage has been reported to occur on either side of G in the sequence GCU (PubMed:19690171). Also reported to cleave after C in GC(A/U) sequences (PubMed:19943910). There are only 14 genes in E.coli W3110 (and probably also MG1655) that do not have a GCU sequence and thus are resistant to the mRNA interferase activity; among these is the gene for toxin GhoT. Overexpression of MqsR causes cessation of cell growth and inhibits cell proliferation via inhibition of translation as well as increasing persister cell formation; these effects are overcome by concomitant or subsequent expression of antitoxin MqsA. Cross-talk can occur between different TA systems. Ectopic expression of this toxin induces transcription of the relBEF TA system operon with specific cleavage of the relBEF mRNA produced (PubMed:23432955). Regulates the expression of GhoT/GhoS, a type V TA system (PubMed:23289863). Persistence depends on toxin GhoT activity, which MqsR controls at the post-transcriptional level by selectively degrading the antitoxin ghoS segment of the ghoST mRNA (PubMed:23289863). Persister cells exhibit antibiotic tolerance without genetic change. mRNA interferases play a role in bacterial persistence to antibiotics; overexpression of this protein induces persisters resistant to coiprofloxacin and ampicillin (PubMed:21788497). Overexpression leads to a dramatic increase in tolerance to the antibiotic ofloxacin. This TA system mediates cell growth during bile acid deoxycholate stress by degrading mRNA for probable deoxycholate-binding protein YgiS; bile acid detergents such as deoxycholate are important for host defense against bacterial growth in the gall bladder and duodenum (PubMed:25534751).