Rabbit anti-Human RGMB Polyclonal Antibody | anti-RGMB antibody

RGMB antibody - C-terminal region

Cat. Num. AAA3215522

• Gene Names: RGMB; DRAGON
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: RGMB; Polyclonal Antibody; RGMB antibody - C-terminal region; anti-RGMB antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: LTTGDANFTAAAHSALEDVEALHPRKERWHIFPSSGNGTPRGGSDLSVSL
• Sequence Length: 478

• Applicable Applications for anti-RGMB antibody: Western Blot (WB)
• Homology: Human: 100%
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RGMB AntibodyTitration: 1.0 ug/mlPositive Control: HCT15 Whole Cell)

Related Product Information for anti-RGMB antibody

This is a rabbit polyclonal antibody against RGMB. It was validated on Western Blot

Target Description: RGMB is a glycosylphosphatidylinositol (GPI)-anchored member of the repulsive guidance molecule family and contributes to the patterning of the developing nervous system.

Product Categories/Family for anti-RGMB antibody

Polyclonal; Transcription Regulation; Various; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 224589135
• NCBI GeneID: 285704
• NCBI Accession #: NP_001012779
• NCBI GenBank Nucleotide #: NM_001012761
• UniProt Accession #: Q6NW40
• Molecular Weight: 53kDa
• NCBI Official Full Name: RGM domain family member B isoform 2
• NCBI Official Synonym Full Names: repulsive guidance molecule BMP co-receptor b
• NCBI Official Symbol: RGMB
• NCBI Official Synonym Symbols: DRAGON
• NCBI Protein Information: RGM domain family member B
• UniProt Protein Name: RGM domain family member B
• Protein Family: RGM domain family
• UniProt Gene Name: RGMB
• UniProt Synonym Gene Names: DRAGON
• UniProt Entry Name: RGMB_HUMAN

NCBI Description

RGMB is a glycosylphosphatidylinositol (GPI)-anchored member of the repulsive guidance molecule family (see RGMA, MIM 607362) and contributes to the patterning of the developing nervous system (Samad et al., 2005 [PubMed 15671031]).[supplied by OMIM, Apr 2009]