Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit anti-Human RGMB Polyclonal Antibody | anti-RGMB antibody

RGMB antibody - C-terminal region

Gene Names
RGMB; DRAGON
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RGMB; Polyclonal Antibody; RGMB antibody - C-terminal region; anti-RGMB antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LTTGDANFTAAAHSALEDVEALHPRKERWHIFPSSGNGTPRGGSDLSVSL
Sequence Length
478
Applicable Applications for anti-RGMB antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RGMB AntibodyTitration: 1.0 ug/mlPositive Control: HCT15 Whole Cell)

Related Product Information for anti-RGMB antibody
This is a rabbit polyclonal antibody against RGMB. It was validated on Western Blot

Target Description: RGMB is a glycosylphosphatidylinositol (GPI)-anchored member of the repulsive guidance molecule family and contributes to the patterning of the developing nervous system.
Product Categories/Family for anti-RGMB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
RGM domain family member B isoform 2
NCBI Official Synonym Full Names
repulsive guidance molecule BMP co-receptor b
NCBI Official Symbol
RGMB
NCBI Official Synonym Symbols
DRAGON
NCBI Protein Information
RGM domain family member B
UniProt Protein Name
RGM domain family member B
Protein Family
UniProt Gene Name
RGMB
UniProt Synonym Gene Names
DRAGON
UniProt Entry Name
RGMB_HUMAN

NCBI Description

RGMB is a glycosylphosphatidylinositol (GPI)-anchored member of the repulsive guidance molecule family (see RGMA, MIM 607362) and contributes to the patterning of the developing nervous system (Samad et al., 2005 [PubMed 15671031]).[supplied by OMIM, Apr 2009]

Research Articles on RGMB

Similar Products

Product Notes

The RGMB rgmb (Catalog #AAA3215522) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RGMB antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RGMB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RGMB rgmb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LTTGDANFTA AAHSALEDVE ALHPRKERWH IFPSSGNGTP RGGSDLSVSL. It is sometimes possible for the material contained within the vial of "RGMB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual