Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

RECK blocking peptide

RECK Peptide - N-terminal region

Gene Names
Reck; St15; mRECK
Reactivity
Mouse
Synonyms
RECK; RECK Peptide - N-terminal region; RECK blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: MNSSLPGVFKKSDGWVGLGCCELAIGLECRQACKQASSKNDISKVCRKEY
Sequence Length
971
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RECK blocking peptide
This is a synthetic peptide designed for use in combination with anti- RECK Antibody, made

Target Description: Negatively regulates matrix metalloproteinase-9 (MMP-9) by suppressing MMP-9 secretion and by direct inhibition of its enzymatic activity. RECK down-regulation by oncogenic signals may facilitate tumor invasion and metastasis. Appears to also regulate MMP-2 and MT1-MMP, which are involved in cancer progression (By similarity).
Product Categories/Family for RECK blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
106 kDa
NCBI Official Full Name
reversion-inducing cysteine-rich protein with Kazal motifs
NCBI Official Synonym Full Names
reversion-inducing-cysteine-rich protein with kazal motifs
NCBI Official Symbol
Reck
NCBI Official Synonym Symbols
St15; mRECK
NCBI Protein Information
reversion-inducing cysteine-rich protein with Kazal motifs
UniProt Protein Name
Reversion-inducing cysteine-rich protein with Kazal motifs
UniProt Gene Name
Reck
UniProt Synonym Gene Names
mRECK
UniProt Entry Name
RECK_MOUSE

Uniprot Description

RECK: Negatively regulates matrix metalloproteinase-9 (MMP-9) by suppressing MMP-9 secretion and by direct inhibition of its enzymatic activity. RECK down-regulation by oncogenic signals may facilitate tumor invasion and metastasis. Appears to also regulate MMP-2 and MT1-MMP, which are involved in cancer progression. Interacts with MMP-9. Expressed in various tissues and untransformed cells. It is undetectable in tumor-derived cell lines and oncogenically transformed cells.

Protein type: Tumor suppressor; Membrane protein, GPI anchor

Cellular Component: membrane; plasma membrane

Molecular Function: endopeptidase inhibitor activity; metalloendopeptidase inhibitor activity; protease inhibitor activity; serine-type endopeptidase inhibitor activity

Biological Process: blood vessel maturation; embryo implantation; embryonic forelimb morphogenesis; extracellular matrix organization and biogenesis; negative regulation of cell migration; negative regulation of peptidase activity; positive regulation of Notch signaling pathway

Research Articles on RECK

Similar Products

Product Notes

The RECK reck (Catalog #AAA3248494) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RECK Peptide - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: MNSSLPGVFK KSDGWVGLGC CELAIGLECR QACKQASSKN DISKVCRKEY. It is sometimes possible for the material contained within the vial of "RECK, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.