Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PDE1B blocking peptide

PDE1B Peptide - middle region

Gene Names
Pde1b; Pde1b1
Reactivity
Mouse
Synonyms
PDE1B; PDE1B Peptide - middle region; PDE1B blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: PTVFLMSFLEALETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLS
Sequence Length
535
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PDE1B blocking peptide
This is a synthetic peptide designed for use in combination with anti- PDE1B Antibody, made

Target Description: Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a preference for cGMP as a substrate (By similarity).
Product Categories/Family for PDE1B blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58 kDa
NCBI Official Full Name
calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B isoform 1
NCBI Official Synonym Full Names
phosphodiesterase 1B, Ca2+-calmodulin dependent
NCBI Official Symbol
Pde1b
NCBI Official Synonym Symbols
Pde1b1
NCBI Protein Information
calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B
UniProt Protein Name
Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B
UniProt Gene Name
Pde1b
UniProt Synonym Gene Names
Pde1b1; Cam-PDE 1B
UniProt Entry Name
PDE1B_MOUSE

Uniprot Description

PDE1B: Cyclic nucleotide phosphodiesterase with a dual- specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a preference for cGMP as a substrate. Belongs to the cyclic nucleotide phosphodiesterase family. PDE1 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Nucleotide Metabolism - purine; EC 3.1.4.17; Phosphodiesterase

Cellular Component: cell soma; cytoplasm

Molecular Function: calmodulin binding; 3',5'-cyclic-AMP phosphodiesterase activity; phosphoric diester hydrolase activity; calmodulin-dependent cyclic-nucleotide phosphodiesterase activity; hydrolase activity; calcium- and calmodulin-regulated 3',5'-cyclic-GMP phosphodiesterase activity; metal ion binding; cyclic-nucleotide phosphodiesterase activity; 3',5'-cyclic-nucleotide phosphodiesterase activity

Biological Process: regulation of neurotransmitter levels; cAMP catabolic process; regulation of dopamine metabolic process; response to amphetamine; visual learning; locomotory behavior; cGMP catabolic process; signal transduction; serotonin metabolic process

Research Articles on PDE1B

Similar Products

Product Notes

The PDE1B pde1b (Catalog #AAA3248346) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PDE1B Peptide - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: PTVFLMSFLE ALETGYGKYK NPYHNQIHAA DVTQTVHCFL LRTGMVHCLS. It is sometimes possible for the material contained within the vial of "PDE1B, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.