Dnmt1 blocking peptide

Dnmt1 Peptide - N-terminal region

Cat. Num. AAA3228395

• Gene Names: Dnmt1; Dnmt; MCMT; Met1; Cxxc9; MTase; Met-1; Dnmt1o; m.MmuI; MommeD2
• Reactivity: Mouse
• Applications: Western Blot
• Synonyms: Dnmt1; Dnmt1 Peptide - N-terminal region; Dnmt1 blocking peptide

• Reactivity: Mouse
• Form/Format: Lyophilized powder
• Sequence: SSVATRRTTRQTTITAHFTKGPTKRKPKEESEEGNSAESAAEERDQDKKR
• Sequence Length: 1619

• Applicable Applications for Dnmt1 blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for Dnmt1 blocking peptide

This is a synthetic peptide designed for use in combination with anti-Dnmt1 Antibody, made

Target Description: Dnmt1 methylates CpG residues.Dnmt1 preferentially methylates hemimethylated DNA. Dnmt1 associates with DNA replication sites in S phase maintaining the methylation pattern in the newly synthesized strand, that is essential for epigenetic inheritance.Dnmt1 associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is responsible for maintaining methylation patterns established in development. DNA methylation is coordinated with methylation of histones.Dnmt1 mediates transcriptional repression by direct binding to HDAC2. In association with DNMT3B and via the recruitment of CTCFL/BORIS, Dnmt1 is involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9.

Product Categories/Family for Dnmt1 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 327180734
• NCBI GeneID: 13433
• NCBI Accession #: NP_034196
• NCBI GenBank Nucleotide #: NM_010066
• UniProt Accession #: P13864
• Molecular Weight: 183kDa
• NCBI Official Full Name: DNA (cytosine-5)-methyltransferase 1 isoform 2
• NCBI Official Synonym Full Names: DNA methyltransferase (cytosine-5) 1
• NCBI Official Symbol: Dnmt1
• NCBI Official Synonym Symbols: Dnmt; MCMT; Met1; Cxxc9; MTase; Met-1; Dnmt1o; m.MmuI; MommeD2
• NCBI Protein Information: DNA (cytosine-5)-methyltransferase 1
• UniProt Protein Name: DNA (cytosine-5)-methyltransferase 1
• UniProt Gene Name: Dnmt1
• UniProt Synonym Gene Names: Dnmt; Met1; Uim; Dnmt1; Met-1; DNA MTase MmuI; M.MmuI
• UniProt Entry Name: DNMT1_MOUSE

NCBI Description

This gene encodes a methyltransferase that preferentially methylates cytosines of CpG residues in hemimethylated DNA to generate fully methylated CpG base pairs during DNA replication. This enzyme plays roles in diverse cellular processes including cell cycle regulation, DNA repair, and telomere maintenance. The encoded protein is composed of an N-terminal domain with a nuclear localization sequence and replication fork-targeting domain, a DNA-binding CXXC domain, two bromo-adjacent homology domains, and a C-terminal catalytic domain. Mouse embryonic stem cells mutant for this gene are viable, but when introduced into the germ line, cause a recessive lethal phenotype with mutant embryos displaying stunted growth and developmental defects. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]