ATP6V0D2 blocking peptide
ATP6V0D2 Peptide-middle region
Reactivity
Mouse
Synonyms
ATP6V0D2; ATP6V0D2 Peptide-middle region; AI324824; V-ATPase; 1620401A02Rik; ATP6V0D2 blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
IITLNSFGTELSKEDRETLFPTCGRLYPEGLRLLAQAEDFEQMKRVADNY
Quality Control
The peptide is characterized by mass spectroscopy
Protein Size
350 amino acids
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ATP6V0D2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ATP6V0D2 Antibody. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Description of Target: Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system (By similarity). May play a role in coupling of proton transport and ATP hydrolysis. Regulator of osteoclast fusion and bone formation.
Description of Target: Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system (By similarity). May play a role in coupling of proton transport and ATP hydrolysis. Regulator of osteoclast fusion and bone formation.
NCBI and Uniprot Product Information
NCBI GeneID
UniProt Accession #
Molecular Weight
38kDa
UniProt Protein Name
V-type proton ATPase subunit d 2
Protein Family
UniProt Gene Name
Atp6v0d2
UniProt Synonym Gene Names
V-ATPase subunit d 2
UniProt Entry Name
VA0D2_MOUSE
Similar Products
Product Notes
The ATP6V0D2 atp6v0d2 (Catalog #AAA3249555) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ATP6V0D2 Peptide-middle region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: IITLNSFGTE LSKEDRETLF PTCGRLYPEG LRLLAQAEDF EQMKRVADNY. It is sometimes possible for the material contained within the vial of "ATP6V0D2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
