Western Blot (WB)
(WB Suggested Anti-ATP6V0D2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Rabbit ATP6V0D2 Polyclonal Antibody | anti-ATP6V0D2 antibody
ATP6V0D2 antibody - middle region
Gene Names
ATP6V0D2; VMA6; ATP6D2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ATP6V0D2; Polyclonal Antibody; ATP6V0D2 antibody - middle region; anti-ATP6V0D2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
Sequence Length
350
Applicable Applications for anti-ATP6V0D2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ATP6V0D2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ATP6V0D2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Western Blot (WB)
(WB Suggested Anti-ATP6V0D2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Related Product Information for anti-ATP6V0D2 antibody
This is a rabbit polyclonal antibody against ATP6V0D2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ATP6V0D2 is the subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. ATP6V0D2 may play a role in coupling of proton transport and ATP hydrolysis.
Target Description: ATP6V0D2 is the subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. ATP6V0D2 may play a role in coupling of proton transport and ATP hydrolysis.
Product Categories/Family for anti-ATP6V0D2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
V-type proton ATPase subunit d 2
NCBI Official Synonym Full Names
ATPase H+ transporting V0 subunit d2
NCBI Official Symbol
ATP6V0D2
NCBI Official Synonym Symbols
VMA6; ATP6D2
NCBI Protein Information
V-type proton ATPase subunit d 2
UniProt Protein Name
V-type proton ATPase subunit d 2
Protein Family
UniProt Gene Name
ATP6V0D2
UniProt Synonym Gene Names
V-ATPase subunit d 2
UniProt Entry Name
VA0D2_HUMAN
Research Articles on ATP6V0D2
Similar Products
Product Notes
The ATP6V0D2 atp6v0d2 (Catalog #AAA3212252) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP6V0D2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ATP6V0D2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATP6V0D2 atp6v0d2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLRLLAQAED FDQMKNVADH YGVYKPLFEA VGGSGGKTLE DVFYEREVQM. It is sometimes possible for the material contained within the vial of "ATP6V0D2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
