V-type proton ATPase subunit d 1 (ATP6V0D1) Recombinant Protein | ATP6V0D1 recombinant protein

Recombinant Human V-type proton ATPase subunit d 1 (ATP6V0D1)

Cat. Num. AAA954606

• Gene Names: ATP6V0D1; P39; VATX; VMA6; ATP6D; ATP6DV; VPATPD
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: V-type proton ATPase subunit d 1 (ATP6V0D1); Recombinant Human V-type proton ATPase subunit d 1 (ATP6V0D1); V-type proton ATPase subunit d 1; V-ATPase subunit d 1; 32 kDa accessory protein; V-ATPase 40 kDa accessory protein; V-ATPase AC39 subunit; p39; Vacuolar proton pump subunit d 1; ATP6V0D1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-351aa; Full Length
• Sequence: MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
• Sequence Length: 351

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for ATP6V0D1 recombinant protein

Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. May play a role in coupling of proton transport and ATP hydrolysis. May play a role in cilium biogenesis through regulation of the transport and the localization of proteins to the cilium

Product Categories/Family for ATP6V0D1 recombinant protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 19913432
• NCBI GeneID: 9114
• NCBI Accession #: NP_004682.2
• NCBI GenBank Nucleotide #: NM_004691.4
• UniProt Accession #: P61421; P12953; Q02547
• Molecular Weight: 67.3 kDa
• NCBI Official Full Name: V-type proton ATPase subunit d 1
• NCBI Official Synonym Full Names: ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1
• NCBI Official Symbol: ATP6V0D1
• NCBI Official Synonym Symbols: P39; VATX; VMA6; ATP6D; ATP6DV; VPATPD
• NCBI Protein Information: V-type proton ATPase subunit d 1; V-ATPase, subunit D; V-ATPase subunit d 1; V-ATPase AC39 subunit; 32 kDa accessory protein; vacuolar proton pump subunit d 1; V-ATPase 40 KDa accessory protein; H(+)-transporting two-sector ATPase, subunit D; ATPase, H+ transporting, lysosomal (vacuolar proton pump), member D
• UniProt Protein Name: V-type proton ATPase subunit d 1
• Protein Family: V-type proton ATPase
• UniProt Gene Name: ATP6V0D1
• UniProt Synonym Gene Names: ATP6D; VPATPD; V-ATPase subunit d 1; p39
• UniProt Entry Name: VA0D1_HUMAN

NCBI Description

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is known as the D subunit and is found ubiquitously. [provided by RefSeq, Jul 2008]

Uniprot Description

ATP6V0D1: Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. May play a role in coupling of proton transport and ATP hydrolysis. Belongs to the V-ATPase V0D/AC39 subunit family.

Protein type: Energy Metabolism - oxidative phosphorylation; EC 3.6.3.14; Vesicle; Hydrolase

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: centrosome; phagocytic vesicle membrane; synaptic vesicle; membrane; lysosomal membrane; apical plasma membrane; early endosome; endosome membrane; vacuolar proton-transporting V-type ATPase complex; nerve terminal

Molecular Function: hydrogen-exporting ATPase activity, phosphorylative mechanism; protein binding; protein complex binding

Biological Process: interaction with host; proton transport; unfolded protein response, activation of signaling protein activity; cellular protein metabolic process; unfolded protein response; cellular iron ion homeostasis; ATP hydrolysis coupled proton transport; insulin receptor signaling pathway; cilium biogenesis; transferrin transport; brain development; transmembrane transport