Mouse FOXO3A Monoclonal Antibody | anti-FOXO3A antibody

FOXO3A (Forkhead Box O3, AF6q21, DKFZp781A0677, FKHRL1, FKHRL1P2, FOXO2, FOXO3A, MGC12739, MGC31925) (FITC)

Cat. Num. AAA6175537

• Gene Names: FOXO3; FOXO2; AF6q21; FKHRL1; FOXO3A; FKHRL1P2
• Applications: Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: FOXO3A; Monoclonal Antibody; FOXO3A (Forkhead Box O3; AF6q21; DKFZp781A0677; FKHRL1; FKHRL1P2; FOXO2; MGC12739; MGC31925) (FITC); Forkhead Box O3; MGC31925; anti-FOXO3A antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 400000000
• Specificity: Recognizes FOXO3A.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 673

• Applicable Applications for anti-FOXO3A antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: FOXO3A (AAH21224, 361aa-460aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFS
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to FOXO3A on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 1 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to FOXO3A on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 1 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged FOXO3A is approximately 0.3ng/ml as a capture antibody.)

Related Product Information for anti-FOXO3A antibody

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq]

Product Categories/Family for anti-FOXO3A antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 18203785
• NCBI GeneID: 2309
• NCBI Official Full Name: Forkhead box O3
• NCBI Official Synonym Full Names: forkhead box O3
• NCBI Official Symbol: FOXO3
• NCBI Official Synonym Symbols: FOXO2; AF6q21; FKHRL1; FOXO3A; FKHRL1P2
• NCBI Protein Information: forkhead box protein O3

NCBI Description

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008]