Mouse anti-Human VPREB3 Monoclonal Antibody | anti-VPREB3 antibody

VPREB3 (Pre-B Lymphocyte Protein 3, Protein VPreB3, N27C7-2, UNQ355/PRO619, 8HS20) (FITC)

Cat. Num. AAA6150447

• Gene Names: VPREB3; 8HS20; N27C7-2
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: VPREB3; Monoclonal Antibody; VPREB3 (Pre-B Lymphocyte Protein 3; Protein VPreB3; N27C7-2; UNQ355/PRO619; 8HS20) (FITC); anti-VPREB3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4H8
• Specificity: Recognizes human VPREB3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-VPREB3 antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa24-124 from human VPREB3 (NP_037510) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of VPREB3 expression in transfected 293T cell line using 135268. Lane 1: VPREB3 transfected lysate (13.7kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-VPREB3 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 7019567
• NCBI GeneID: 29802
• NCBI Accession #: NP_037510
• NCBI GenBank Nucleotide #: NM_013378
• UniProt Accession #: Q9UKI3
• Molecular Weight: 13kDa
• NCBI Official Full Name: pre-B lymphocyte protein 3
• NCBI Official Synonym Full Names: V-set pre-B cell surrogate light chain 3
• NCBI Official Symbol: VPREB3
• NCBI Official Synonym Symbols: 8HS20; N27C7-2
• NCBI Protein Information: pre-B lymphocyte protein 3
• UniProt Protein Name: Pre-B lymphocyte protein 3
• Protein Family: Pre-B lymphocyte protein
• UniProt Gene Name: VPREB3

NCBI Description

The protein encoded by this gene is the human ortholog of the mouse VpreB3 (8HS20) protein, is thought to be involved in B-cell maturation, and may play a role in assembly of the pre-B cell receptor (pre-BCR). While the role of this protein in B-cell development has not yet been elucidated, studies with the chicken ortholog of this protein have found that when overexpressed, this protein localizes to the endoplasmic reticulum. The mouse ortholog of this protein has been shown to associate with membrane mu heavy chains early in the course of pre-B cell receptor biosynthesis. Expression of this gene has been observed in some lymphomas. [provided by RefSeq, Apr 2015]

Uniprot Description

VPREB3: Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells. Belongs to the immunoglobulin superfamily.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 22q11.23|22q11

Cellular Component: endoplasmic reticulum; extracellular region; extracellular space

Biological Process: immune response; immunoglobulin production; leukocyte migration