Mouse PAX7 Monoclonal Antibody | anti-PAX7 antibody

PAX7 (Paired Box 7, HUP1, PAX7B) (Biotin)

Cat. Num. AAA6171582

• Gene Names: PAX7; HUP1; RMS2; PAX7B
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: PAX7; Monoclonal Antibody; PAX7 (Paired Box 7; HUP1; PAX7B) (Biotin); Paired Box 7; PAX7B; anti-PAX7 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1G11
• Specificity: Recognizes PAX7.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-PAX7 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PAX7 (NP_002575.1, 411aa-520aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PAX7 monoclonal antibody (M07), clone 1G11 Western Blot analysis of PAX7 expression in Hela S3 NE.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PAX7 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PAX7 on HeLa cell. [antibody concentration 10 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PAX7 is approximately 1ng/ml as a capture antibody.)

Related Product Information for anti-PAX7 antibody

This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-PAX7 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 207029268
• NCBI GeneID: 5081
• NCBI Accession #: NP_002575.1
• NCBI GenBank Nucleotide #: NM_002584
• Molecular Weight: 55,119 Da
• NCBI Official Full Name: Homo sapiens paired box 7 (PAX7), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: paired box 7
• NCBI Official Symbol: PAX7
• NCBI Official Synonym Symbols: HUP1; RMS2; PAX7B
• NCBI Protein Information: paired box protein Pax-7; PAX7 transcriptional factor; paired box homeotic gene 7; paired domain gene 7
• Protein Family: Paired box protein

NCBI Description

This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2008]