Mouse anti-Human VAT1 Monoclonal Antibody | anti-VAT1 antibody

VAT1 (Synaptic Vesicle Membrane Protein VAT-1 Homolog, VATI) (Biotin)

Cat. Num. AAA6145124

• Gene Names: VAT1; VATI
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: VAT1; Monoclonal Antibody; VAT1 (Synaptic Vesicle Membrane Protein VAT-1 Homolog; VATI) (Biotin); Vesicle Amine Transport Protein 1 Homolog (T. californica); EC=1.-.-.-; anti-VAT1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3E9
• Specificity: Recognizes human VAT1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 2699

• Applicable Applications for anti-VAT1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa294-392 from VAT1 (NP_006364) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PKRNLMALARTWWNQFSVTALQLLQANRAVCGFHLGYLDGEVELVSGVVARLLALYNQGHIKPHIDSVWPFEKVADAMKQMQEKKNVGKVLLVPGPEKE
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(VAT1 monoclonal antibody Western Blot analysis of VAT1 expression in MCF-7)

Testing Data

(Detection limit for recombinant GST tagged VAT1 is 0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-VAT1 antibody

Antibodies; Membrane Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 1519245434
• NCBI GeneID: 10493
• NCBI Accession #: NM_006373.4
• NCBI GenBank Nucleotide #: NM_006373
• UniProt Accession #: Q99536
• NCBI Official Full Name: Homo sapiens vesicle amine transport 1 (VAT1), mRNA
• NCBI Official Synonym Full Names: vesicle amine transport 1
• NCBI Official Symbol: VAT1
• NCBI Official Synonym Symbols: VATI
• NCBI Protein Information: synaptic vesicle membrane protein VAT-1 homolog
• UniProt Protein Name: Synaptic vesicle membrane protein VAT-1 homolog
• Protein Family: Synaptic vesicle membrane protein
• UniProt Gene Name: VAT1
• UniProt Entry Name: VAT1_HUMAN

NCBI Description

Synaptic vesicles are responsible for regulating the storage and release of neurotransmitters in the nerve terminal. The protein encoded by this gene is an abundant integral membrane protein of cholinergic synaptic vesicles and is thought to be involved in vesicular transport. It belongs to the quinone oxidoreductase subfamily of zinc-containing alcohol dehydrogenase proteins. [provided by RefSeq, Jul 2008]

Uniprot Description

VAT1: Possesses ATPase activity. Plays a part in calcium-regulated keratinocyte activation in epidermal repair mechanisms. Has no effect on cell proliferation. Negatively regulates mitochondrial fusion in cooperation with mitofusin proteins (MFN1-2). Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.

Protein type: Membrane protein, integral; Oxidoreductase; EC 1.-.-.-

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: mitochondrial outer membrane; integral to membrane

Molecular Function: zinc ion binding; oxidoreductase activity