Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (VAT1 monoclonal antibody Western Blot analysis of VAT1 expression in MCF-7)

Mouse anti-Human VAT1 Monoclonal Antibody | anti-VAT1 antibody

VAT1 (Synaptic Vesicle Membrane Protein VAT-1 Homolog, VATI) APC

Gene Names
VAT1; VATI
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
VAT1; Monoclonal Antibody; VAT1 (Synaptic Vesicle Membrane Protein VAT-1 Homolog; VATI) APC; Vesicle Amine Transport Protein 1 Homolog (T. californica); EC=1.-.-.-; anti-VAT1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E9
Specificity
Recognizes human VAT1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
2699
Applicable Applications for anti-VAT1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa294-392 from VAT1 (NP_006364) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PKRNLMALARTWWNQFSVTALQLLQANRAVCGFHLGYLDGEVELVSGVVARLLALYNQGHIKPHIDSVWPFEKVADAMKQMQEKKNVGKVLLVPGPEKE
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(VAT1 monoclonal antibody Western Blot analysis of VAT1 expression in MCF-7)

Western Blot (WB) (VAT1 monoclonal antibody Western Blot analysis of VAT1 expression in MCF-7)

Testing Data

(Detection limit for recombinant GST tagged VAT1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged VAT1 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-VAT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens vesicle amine transport 1 (VAT1), mRNA
NCBI Official Synonym Full Names
vesicle amine transport 1
NCBI Official Symbol
VAT1
NCBI Official Synonym Symbols
VATI
NCBI Protein Information
synaptic vesicle membrane protein VAT-1 homolog
UniProt Protein Name
Synaptic vesicle membrane protein VAT-1 homolog
UniProt Gene Name
VAT1
UniProt Entry Name
VAT1_HUMAN

NCBI Description

Synaptic vesicles are responsible for regulating the storage and release of neurotransmitters in the nerve terminal. The protein encoded by this gene is an abundant integral membrane protein of cholinergic synaptic vesicles and is thought to be involved in vesicular transport. It belongs to the quinone oxidoreductase subfamily of zinc-containing alcohol dehydrogenase proteins. [provided by RefSeq, Jul 2008]

Uniprot Description

VAT1: Possesses ATPase activity. Plays a part in calcium-regulated keratinocyte activation in epidermal repair mechanisms. Has no effect on cell proliferation. Negatively regulates mitochondrial fusion in cooperation with mitofusin proteins (MFN1-2). Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.

Protein type: Membrane protein, integral; Oxidoreductase; EC 1.-.-.-

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: mitochondrial outer membrane; integral to membrane

Molecular Function: zinc ion binding; oxidoreductase activity

Research Articles on VAT1

Similar Products

Product Notes

The VAT1 vat1 (Catalog #AAA6139821) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The VAT1 (Synaptic Vesicle Membrane Protein VAT-1 Homolog, VATI) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VAT1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the VAT1 vat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "VAT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.