Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (VAMP1 monoclonal antibody (M01), clone 5F3. Western Blot analysis of VAMP1 expression in HepG2 (Cat # L019V1).)

Mouse VAMP1 Monoclonal Antibody | anti-VAMP1 antibody

VAMP1 (Vesicle-Associated Membrane Protein 1 (synaptobrevin 1), DKFZp686H12131, SYB1, VAMP-1) (FITC)

Gene Names
VAMP1; SYB1; SPAX1; VAMP-1
Applications
Western Blot
Purity
Purified
Synonyms
VAMP1; Monoclonal Antibody; VAMP1 (Vesicle-Associated Membrane Protein 1 (synaptobrevin 1); DKFZp686H12131; SYB1; VAMP-1) (FITC); Vesicle-Associated Membrane Protein 1 (synaptobrevin 1); VAMP-1; anti-VAMP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a, lambda
Clone Number
5F3
Specificity
Recognizes VAMP1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-VAMP1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
VAMP1 (NP_055046, 28aa-96aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(VAMP1 monoclonal antibody (M01), clone 5F3. Western Blot analysis of VAMP1 expression in HepG2 (Cat # L019V1).)

Western Blot (WB) (VAMP1 monoclonal antibody (M01), clone 5F3. Western Blot analysis of VAMP1 expression in HepG2 (Cat # L019V1).)

Testing Data

(Detection limit for recombinant GST tagged VAMP1 is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged VAMP1 is approximately 0.1ng/ml as a capture antibody.)
Related Product Information for anti-VAMP1 antibody
Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. VAMP1 is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Multiple alternative splice variants that encode proteins with alternative carboxy ends have been described, but the full-length nature of some variants has not been defined. [provided by RefSeq]
Product Categories/Family for anti-VAMP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11.9 kDa (111 aa), confirmed by MALDI-TOF.
NCBI Official Full Name
vesicle-associated membrane protein 1 isoform 1
NCBI Official Synonym Full Names
vesicle associated membrane protein 1
NCBI Official Symbol
VAMP1
NCBI Official Synonym Symbols
SYB1; SPAX1; VAMP-1
NCBI Protein Information
vesicle-associated membrane protein 1
UniProt Protein Name
Vesicle-associated membrane protein 1
UniProt Gene Name
VAMP1
UniProt Synonym Gene Names
SYB1; VAMP-1
UniProt Entry Name
VAMP1_HUMAN

NCBI Description

Synapotobrevins, syntaxins, and the synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Mutations in this gene are associated with autosomal dominant spastic ataxia 1. Multiple alternative splice variants have been described, but the full-length nature of some variants has not been defined. [provided by RefSeq, Jul 2014]

Uniprot Description

VAMP1: Involved in the targeting and/or fusion of transport vesicles to their target membrane. Belongs to the synaptobrevin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p

Cellular Component: SNARE complex; synaptic vesicle; mitochondrial outer membrane; neuron projection; cell surface; synaptic vesicle membrane; integral to plasma membrane; cell junction; cytosol

Molecular Function: SNAP receptor activity; SNARE binding; protein binding

Biological Process: vesicle fusion; exocytosis; pathogenesis

Disease: Spastic Ataxia 1, Autosomal Dominant

Research Articles on VAMP1

Similar Products

Product Notes

The VAMP1 vamp1 (Catalog #AAA6176995) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's VAMP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the VAMP1 vamp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "VAMP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.