Mouse VAMP1 Monoclonal Antibody | anti-VAMP1 antibody

VAMP1 (Vesicle-Associated Membrane Protein 1 (synaptobrevin 1), DKFZp686H12131, SYB1, VAMP-1) (PE)

Cat. Num. AAA6185815

• Gene Names: VAMP1; SYB1; SPAX1; VAMP-1
• Applications: Western Blot
• Purity: Purified
• Synonyms: VAMP1; Monoclonal Antibody; VAMP1 (Vesicle-Associated Membrane Protein 1 (synaptobrevin 1); DKFZp686H12131; SYB1; VAMP-1) (PE); Vesicle-Associated Membrane Protein 1 (synaptobrevin 1); VAMP-1; anti-VAMP1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a, lambda
• Clone Number: 5F3
• Specificity: Recognizes VAMP1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-VAMP1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: VAMP1 (NP_055046, 28aa-96aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCK
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(VAMP1 monoclonal antibody (M01), clone 5F3. Western Blot analysis of VAMP1 expression in HepG2 (Cat # L019V1).)

Testing Data

(Detection limit for recombinant GST tagged VAMP1 is approximately 0.1ng/ml as a capture antibody.)

Related Product Information for anti-VAMP1 antibody

Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. VAMP1 is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Multiple alternative splice variants that encode proteins with alternative carboxy ends have been described, but the full-length nature of some variants has not been defined. [provided by RefSeq]

Product Categories/Family for anti-VAMP1 antibody

Antibodies; Membrane Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 7657673
• NCBI GeneID: 6843
• NCBI Accession #: NP_055046
• NCBI GenBank Nucleotide #: NM_014231.4
• UniProt Accession #: P23763; O75468; Q15857; Q6FG94; Q8IVC9; A8MVP3; D3DUR3
• Molecular Weight: 11.9 kDa (111 aa), confirmed by MALDI-TOF.
• NCBI Official Full Name: vesicle-associated membrane protein 1 isoform 1
• NCBI Official Synonym Full Names: vesicle associated membrane protein 1
• NCBI Official Symbol: VAMP1
• NCBI Official Synonym Symbols: SYB1; SPAX1; VAMP-1
• NCBI Protein Information: vesicle-associated membrane protein 1
• UniProt Protein Name: Vesicle-associated membrane protein 1
• Protein Family: Vesicle-associated membrane protein
• UniProt Gene Name: VAMP1
• UniProt Synonym Gene Names: SYB1; VAMP-1
• UniProt Entry Name: VAMP1_HUMAN

NCBI Description

Synapotobrevins, syntaxins, and the synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Mutations in this gene are associated with autosomal dominant spastic ataxia 1. Multiple alternative splice variants have been described, but the full-length nature of some variants has not been defined. [provided by RefSeq, Jul 2014]

Uniprot Description

VAMP1: Involved in the targeting and/or fusion of transport vesicles to their target membrane. Belongs to the synaptobrevin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p

Cellular Component: SNARE complex; synaptic vesicle; mitochondrial outer membrane; neuron projection; cell surface; synaptic vesicle membrane; integral to plasma membrane; cell junction; cytosol

Molecular Function: SNAP receptor activity; SNARE binding; protein binding

Biological Process: vesicle fusion; exocytosis; pathogenesis

Disease: Spastic Ataxia 1, Autosomal Dominant