Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human UNC5D Monoclonal Antibody | anti-UNC5D antibody

UNC5D (Protein Unc-5 Homolog D, Netrin Receptor UNC5D, Protein Unc-5 Homolog 4, UNC5H4, KIAA1777, UNQ6012/PRO34692) (MaxLight 650)

Gene Names
UNC5D; Unc5h4; PRO34692
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UNC5D; Monoclonal Antibody; UNC5D (Protein Unc-5 Homolog D; Netrin Receptor UNC5D; Protein Unc-5 Homolog 4; UNC5H4; KIAA1777; UNQ6012/PRO34692) (MaxLight 650); anti-UNC5D antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G3
Specificity
Recognizes human UNC5D.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
953
Applicable Applications for anti-UNC5D antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa31-131 from human UNC5D (NP_543148) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TDNGEALPESIPSAPGTLPHFIEEPDDAYIIKSNPIALRCKARPAMQIFFKCNGEWVHQNEHVSEETLDESSGLKVREVFINVTRQQVEDFHGPEDYWCQ
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-UNC5D antibody
MaxLight650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor647, DyLight649, Cy5 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
Product Categories/Family for anti-UNC5D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
netrin receptor UNC5D isoform 1
NCBI Official Synonym Full Names
unc-5 netrin receptor D
NCBI Official Symbol
UNC5D
NCBI Official Synonym Symbols
Unc5h4; PRO34692
NCBI Protein Information
netrin receptor UNC5D
UniProt Protein Name
Netrin receptor UNC5D
Protein Family
UniProt Gene Name
UNC5D

Uniprot Description

Receptor for the netrin NTN4 that promotes neuronal cell survival (). Plays a role in cell-cell adhesion and cell guidance. Receptor for netrin involved in cell migration. Plays a role in axon guidance by mediating axon repulsion of neuronal growth cones in the developing nervous system upon ligand binding (). May play a role in apoptosis in response to DNA damage (PubMed:24691657). It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand (PubMed:24519068). Mediates cell-cell adhesion via its interaction with FLRT3 on an adjacent cell ().

Research Articles on UNC5D

Similar Products

Product Notes

The UNC5D unc5d (Catalog #AAA6225360) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UNC5D (Protein Unc-5 Homolog D, Netrin Receptor UNC5D, Protein Unc-5 Homolog 4, UNC5H4, KIAA1777, UNQ6012/PRO34692) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UNC5D can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UNC5D unc5d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UNC5D, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.