Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against immunogen (36.41kD) using MBS6011262.)

Mouse anti-Human TSPAN32 Monoclonal Antibody | anti-TSPAN32 antibody

TSPAN32 (Tetraspanin-32, Tspan-32, ART1, Protein Phemx, PHEMX, PHMX, TSSC6)

Gene Names
TSPAN32; ART1; PHMX; PHEMX; TSSC6
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
TSPAN32; Monoclonal Antibody; TSPAN32 (Tetraspanin-32; Tspan-32; ART1; Protein Phemx; PHEMX; PHMX; TSSC6); Anti -TSPAN32 (Tetraspanin-32; anti-TSPAN32 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2B4
Specificity
Recognizes human TSPAN32.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
RCGCSLDRKGKYTLTPRACGRQPQEPSLLRCSQGGPTHCLHSEAVAIGPRGCSGSLRWLQESDAAPLPLSCHLAAHRALQGRSRGGLSGCPERGLSD
Applicable Applications for anti-TSPAN32 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa194-290 from TSPAN32 (NP_005696) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen (36.41kD) using MBS6011262.)

Western Blot (WB) (Western Blot detection against immunogen (36.41kD) using MBS6011262.)

Western Blot (WB)

(Western Blot analysis of TSPAN32 expression in Hela NE using MBS6011262.)

Western Blot (WB) (Western Blot analysis of TSPAN32 expression in Hela NE using MBS6011262.)

Testing Data

(Detection limit forMBS6011262 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit forMBS6011262 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-TSPAN32 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
34,631 Da
NCBI Official Full Name
TSPAN32 protein
NCBI Official Synonym Full Names
tetraspanin 32
NCBI Official Symbol
TSPAN32
NCBI Official Synonym Symbols
ART1; PHMX; PHEMX; TSSC6
NCBI Protein Information
tetraspanin-32; tspan-32; protein Phemx; tumor-suppressing STF cDNA 6; pan-hematopoietic expression protein; tumor-suppressing subtransferable candidate 6; tumor-suppressing subchromosomal transferable fragment cDNA 6
UniProt Protein Name
Tetraspanin-32
Protein Family
UniProt Gene Name
TSPAN32
UniProt Synonym Gene Names
PHEMX; TSSC6; Tspan-32
UniProt Entry Name
TSN32_HUMAN

NCBI Description

This gene, which is a member of the tetraspanin superfamily, is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of chromosome 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian and breast cancers. This gene is located among several imprinted genes; however, this gene, as well as the tumor-suppressing subchromosomal transferable fragment 4, escapes imprinting. This gene may play a role in malignancies and diseases that involve this region, and it is also involved in hematopoietic cell function. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

TSPAN32: This gene, which is a member of the tetraspanin superfamily, is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of chromosome 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian and breast cancers. This gene is located among several imprinted genes; however, this gene, as well as the tumor-suppressing subchromosomal transferable fragment 4, escapes imprinting. This gene may play a role in malignancies and diseases that involve this region, and it is also involved in hematopoietic cell function. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: cell surface; intracellular

Biological Process: integrin-mediated signaling pathway; negative regulation of cell proliferation; cell-cell signaling; negative regulation of myeloid dendritic cell activation; regulation of defense response to virus; cytoskeleton organization and biogenesis; defense response to protozoan

Research Articles on TSPAN32

Similar Products

Product Notes

The TSPAN32 tspan32 (Catalog #AAA6011262) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TSPAN32 (Tetraspanin-32, Tspan-32, ART1, Protein Phemx, PHEMX, PHMX, TSSC6) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TSPAN32 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the TSPAN32 tspan32 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RCGCSLDRKG KYTLTPRACG RQPQEPSLLR CSQGGPTHCL HSEAVAIGPR GCSGSLRWLQ ESDAAPLPLS CHLAAHRALQ GRSRGGLSGC PERGLSD. It is sometimes possible for the material contained within the vial of "TSPAN32, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.